BLASTX nr result
ID: Cephaelis21_contig00033554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033554 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514555.1| menaquinone biosynthesis protein, putative [... 58 9e-07 >ref|XP_002514555.1| menaquinone biosynthesis protein, putative [Ricinus communis] gi|223546159|gb|EEF47661.1| menaquinone biosynthesis protein, putative [Ricinus communis] Length = 1679 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/51 (62%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -2 Query: 246 QCHGIQVTGNRGIGGIDGLTSTTIGFVVGCNKQV-SMNTP*SQFHDLLKLS 97 QC GIQV GNRG GIDGL ST IGF VGCNK+V S+ S HD LS Sbjct: 774 QCLGIQVAGNRGASGIDGLLSTAIGFAVGCNKRVLSLIGDVSFLHDTNGLS 824