BLASTX nr result
ID: Cephaelis21_contig00033301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033301 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-11 ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 577 Score = 72.0 bits (175), Expect(2) = 2e-11 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 137 VASNAMIVVFSKNGCVQDAKELFDVMSEKNSCSWNSMITCYCKVG 3 VA+NAMI SK+G V++A+ LFD M+E+NSCSWNSMITCYCK+G Sbjct: 77 VANNAMISALSKHGYVEEARNLFDNMTERNSCSWNSMITCYCKLG 121 Score = 21.6 bits (44), Expect(2) = 2e-11 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 207 DFYAKVGD 184 DFYAKVGD Sbjct: 53 DFYAKVGD 60 >ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 743 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/64 (43%), Positives = 39/64 (60%) Frame = -1 Query: 194 RWVISFCKAGVRKNAG*RCVASNAMIVVFSKNGCVQDAKELFDVMSEKNSCSWNSMITCY 15 RWV S+ + R G SNAM+ +++K G V+DAK LFD M EK+ SW +M+ Y Sbjct: 257 RWVHSYIE---RNRIGESLTLSNAMLDMYTKCGSVEDAKRLFDKMPEKDIVSWTTMLVGY 313 Query: 14 CKVG 3 K+G Sbjct: 314 AKIG 317