BLASTX nr result
ID: Cephaelis21_contig00033279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033279 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522430.1| pentatricopeptide repeat-containing protein,... 79 3e-13 ref|XP_004161713.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 67 1e-09 ref|XP_004142727.1| PREDICTED: putative pentatricopeptide repeat... 67 1e-09 ref|XP_003551291.1| PREDICTED: putative pentatricopeptide repeat... 67 2e-09 emb|CBI17483.3| unnamed protein product [Vitis vinifera] 66 3e-09 >ref|XP_002522430.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538315|gb|EEF39922.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 556 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/64 (56%), Positives = 51/64 (79%) Frame = +3 Query: 57 TITDHLTHQTHGAPMFNMLLINSQLKELVKSGPLSEARKMFDELPCRDEVSWTNMISGYV 236 ++ ++L+H+T + + NML INS+LK LVK+G L +AR+MFDE+P RDE+SWT +ISGYV Sbjct: 31 SVPNNLSHKTQPSNLINMLEINSKLKALVKTGCLQDARQMFDEMPHRDEISWTTIISGYV 90 Query: 237 NVSD 248 N D Sbjct: 91 NAID 94 >ref|XP_004161713.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g47840-like [Cucumis sativus] Length = 712 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = +3 Query: 72 LTHQTHGAPMFNMLLINSQLKELVKSGPLSEARKMFDELPCRDEVSWTNMISGYVNVSDM 251 LT H + ++ N+QLK LVK+ L +AR +FD+LP RDEVSWTN+ISGYVN SD Sbjct: 37 LTLNAHFSNKVDLAEANNQLKILVKTNHLKDARDLFDQLPQRDEVSWTNIISGYVNSSDS 96 Query: 252 S 254 S Sbjct: 97 S 97 >ref|XP_004142727.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g47840-like [Cucumis sativus] Length = 712 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = +3 Query: 72 LTHQTHGAPMFNMLLINSQLKELVKSGPLSEARKMFDELPCRDEVSWTNMISGYVNVSDM 251 LT H + ++ N+QLK LVK+ L +AR +FD+LP RDEVSWTN+ISGYVN SD Sbjct: 37 LTLNAHFSNKVDLAEANNQLKILVKTNHLKDARDLFDQLPQRDEVSWTNIISGYVNSSDS 96 Query: 252 S 254 S Sbjct: 97 S 97 >ref|XP_003551291.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g47840-like [Glycine max] Length = 733 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = +3 Query: 105 NMLLINSQLKELVKSGPLSEARKMFDELPCRDEVSWTNMISGYVNVSD 248 NML +NS+LK+LVK G L +AR MFD++ RDE+SWT +I+GYVN SD Sbjct: 56 NMLELNSELKQLVKQGQLCKARYMFDKMTHRDEISWTTLIAGYVNASD 103 >emb|CBI17483.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = +3 Query: 66 DHLTHQTHGAPMFNMLLINSQLKELVKSGPLSEARKMFDELPCRDEVSWTNMISGYVNVS 245 D+L+ H ++ N QLKELVK+G L AR+MFD++ +DE+SWT +ISGYVN + Sbjct: 42 DNLSQNIHFISQTDLPESNKQLKELVKTGHLGNARRMFDKMSQKDEISWTTLISGYVNAN 101 Query: 246 DMS 254 D S Sbjct: 102 DSS 104