BLASTX nr result
ID: Cephaelis21_contig00033130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033130 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316880.1| NAC domain protein, IPR003441 [Populus trich... 82 3e-14 emb|CBI20259.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002282655.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2 [V... 81 1e-13 emb|CAN71645.1| hypothetical protein VITISV_041776 [Vitis vinifera] 81 1e-13 ref|XP_002531329.1| transcription factor, putative [Ricinus comm... 80 2e-13 >ref|XP_002316880.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222859945|gb|EEE97492.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 301 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 141 MASYHYQYVDGNDAHLPPGFRFHPTDEELITYYLLKKVMDSNFTGKA 1 M SYH+ D DAHLPPGFRFHPTDEELITYYLLKKV+DSNFTG+A Sbjct: 1 MESYHH--FDSGDAHLPPGFRFHPTDEELITYYLLKKVLDSNFTGRA 45 >emb|CBI20259.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 126 YQYVDGNDAHLPPGFRFHPTDEELITYYLLKKVMDSNFTGKA 1 Y + D +DAHLPPGFRFHPTDEELITYYL+KKV+DSNFTG+A Sbjct: 4 YHHFDNSDAHLPPGFRFHPTDEELITYYLIKKVLDSNFTGRA 45 >ref|XP_002282655.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2 [Vitis vinifera] Length = 363 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 126 YQYVDGNDAHLPPGFRFHPTDEELITYYLLKKVMDSNFTGKA 1 Y + D +DAHLPPGFRFHPTDEELITYYL+KKV+DSNFTG+A Sbjct: 4 YHHFDNSDAHLPPGFRFHPTDEELITYYLIKKVLDSNFTGRA 45 >emb|CAN71645.1| hypothetical protein VITISV_041776 [Vitis vinifera] Length = 176 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 126 YQYVDGNDAHLPPGFRFHPTDEELITYYLLKKVMDSNFTGKA 1 Y + D +DAHLPPGFRFHPTDEELITYYL+KKV+DSNFTG+A Sbjct: 4 YHHFDNSDAHLPPGFRFHPTDEELITYYLIKKVLDSNFTGRA 45 >ref|XP_002531329.1| transcription factor, putative [Ricinus communis] gi|223529068|gb|EEF31052.1| transcription factor, putative [Ricinus communis] Length = 350 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -2 Query: 129 HYQYVDGNDA-HLPPGFRFHPTDEELITYYLLKKVMDSNFTGKA 1 HY++ D DA HLPPGFRFHPTDEELITYYLLKKV+DSNFTG+A Sbjct: 3 HYRHFDNGDAGHLPPGFRFHPTDEELITYYLLKKVLDSNFTGRA 46