BLASTX nr result
ID: Cephaelis21_contig00033098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033098 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 64 1e-08 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 174 MGQKIKRFYFVSRDPPQVGFESRVMGDFPTRFGE 73 MGQ+IKRF FVSRD PQVGFESRVMGD+P RFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +1 Query: 7 WEEPLPSCLIRGASIHQRRLKVLSEPCGKVTHHTALKPNLW-WIPGDKVKALDLLPHTLR 183 ++ L S L RG SI Q RLKVL EPC +T++T GD VKALD LPHTL+ Sbjct: 6 YKNSLLSYLTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLK 65 Query: 184 CSSPPIK 204 SS PIK Sbjct: 66 GSSTPIK 72