BLASTX nr result
ID: Cephaelis21_contig00032755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032755 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863715.1| zinc finger family protein [Arabidopsis lyra... 54 1e-05 >ref|XP_002863715.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297309550|gb|EFH39974.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 682 Score = 54.3 bits (129), Expect = 1e-05 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%) Frame = +3 Query: 138 DLYRILRLHLHNAKQDQLNSLVDDLADYLSQL--ETISQFVASRTCQDGDA----LDICM 299 D YR +RL + N ++L +L + + D + + ETIS + R + + C Sbjct: 570 DRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNRLKQRKYKSNTKSPQDTEPCC 629 Query: 300 LCQSEYERGDMLGTLECGHEYH 365 +CQ EY G+ +GTLECGHE+H Sbjct: 630 ICQEEYNEGEDMGTLECGHEFH 651