BLASTX nr result
ID: Cephaelis21_contig00032507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00032507 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527241.1| APO protein 4, mitochondrial precursor, puta... 57 2e-06 >ref|XP_002527241.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis] gi|223533417|gb|EEF35167.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis] Length = 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 402 APAIVDLCTKAGAVAPSKYHCMMKVDGLTA 313 APAIVDLCTKAGA+AP+KY+CMMK GLTA Sbjct: 294 APAIVDLCTKAGAIAPTKYYCMMKNQGLTA 323