BLASTX nr result
ID: Cephaelis21_contig00030968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030968 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265112.1| PREDICTED: carboxypeptidase D [Vitis vinifer... 56 4e-06 >ref|XP_002265112.1| PREDICTED: carboxypeptidase D [Vitis vinifera] gi|296083126|emb|CBI22762.3| unnamed protein product [Vitis vinifera] Length = 493 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 443 KTGVHGRIFSSDYGRPLPASIVIKGINYTV 354 KTGVHGRIFSSD GRPLP I IKGINYTV Sbjct: 341 KTGVHGRIFSSDRGRPLPGYITIKGINYTV 370