BLASTX nr result
ID: Cephaelis21_contig00030928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030928 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37517.1| unknown [Medicago truncatula] 157 1e-36 ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like... 155 3e-36 ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like... 153 1e-35 ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus... 153 2e-35 ref|XP_003521931.1| PREDICTED: methionine aminopeptidase 1A-like... 152 3e-35 >gb|AFK37517.1| unknown [Medicago truncatula] Length = 397 Score = 157 bits (396), Expect = 1e-36 Identities = 72/76 (94%), Positives = 74/76 (97%) Frame = +3 Query: 3 NIPHYARNKAVGIMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKHSAQFEHTLLVT 182 NIPHY RNKAVG+MKAGQTFTIEPMINAGVWRDR+WPDGWTAVTADGK SAQFEHTLLVT Sbjct: 315 NIPHYGRNKAVGVMKAGQTFTIEPMINAGVWRDRLWPDGWTAVTADGKRSAQFEHTLLVT 374 Query: 183 ETGVEVLTGRLPTSPN 230 ETGVEVLTGRLPTSPN Sbjct: 375 ETGVEVLTGRLPTSPN 390 >ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like [Glycine max] Length = 397 Score = 155 bits (392), Expect = 3e-36 Identities = 72/76 (94%), Positives = 74/76 (97%) Frame = +3 Query: 3 NIPHYARNKAVGIMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKHSAQFEHTLLVT 182 NIPHY+RNKAVG+MKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGK SAQFEHTLLVT Sbjct: 315 NIPHYSRNKAVGVMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVT 374 Query: 183 ETGVEVLTGRLPTSPN 230 ETGVEVLTGRL TSPN Sbjct: 375 ETGVEVLTGRLQTSPN 390 >ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] gi|449528877|ref|XP_004171428.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] Length = 402 Score = 153 bits (387), Expect = 1e-35 Identities = 71/75 (94%), Positives = 72/75 (96%) Frame = +3 Query: 3 NIPHYARNKAVGIMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKHSAQFEHTLLVT 182 NIPHY RNKAVG+MKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGK SAQFEHTLLVT Sbjct: 321 NIPHYGRNKAVGVMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVT 380 Query: 183 ETGVEVLTGRLPTSP 227 ETGVEVLT RLPTSP Sbjct: 381 ETGVEVLTARLPTSP 395 >ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus communis] gi|223548861|gb|EEF50350.1| methionine aminopeptidase, putative [Ricinus communis] Length = 397 Score = 153 bits (386), Expect = 2e-35 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = +3 Query: 3 NIPHYARNKAVGIMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKHSAQFEHTLLVT 182 NIPHY RNKAVG+MKAGQTFTIEPMIN+GVWRDRMWPDGWTAVTADGK SAQFEHTLLVT Sbjct: 315 NIPHYGRNKAVGVMKAGQTFTIEPMINSGVWRDRMWPDGWTAVTADGKRSAQFEHTLLVT 374 Query: 183 ETGVEVLTGRLPTSPN 230 ETGVEVLT RLP+SPN Sbjct: 375 ETGVEVLTARLPSSPN 390 >ref|XP_003521931.1| PREDICTED: methionine aminopeptidase 1A-like [Glycine max] Length = 397 Score = 152 bits (384), Expect = 3e-35 Identities = 71/76 (93%), Positives = 73/76 (96%) Frame = +3 Query: 3 NIPHYARNKAVGIMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKHSAQFEHTLLVT 182 NIPHY+RNKAVG+MKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGK SAQFE TLLVT Sbjct: 315 NIPHYSRNKAVGVMKAGQTFTIEPMINAGVWRDRMWPDGWTAVTADGKRSAQFEQTLLVT 374 Query: 183 ETGVEVLTGRLPTSPN 230 ETGVEVLTGRL TSPN Sbjct: 375 ETGVEVLTGRLQTSPN 390