BLASTX nr result
ID: Cephaelis21_contig00030806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030806 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 85 5e-15 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 77 1e-12 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +2 Query: 74 VYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARF 193 +YRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARF Sbjct: 40 LYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARF 79 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 193 KPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHG 89 KPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 569 KPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603