BLASTX nr result
ID: Cephaelis21_contig00030764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030764 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_004142577.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002523296.1| pentatricopeptide repeat-containing protein,... 68 7e-10 >ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Cucumis sativus] Length = 512 Score = 76.6 bits (187), Expect = 2e-12 Identities = 42/75 (56%), Positives = 50/75 (66%) Frame = +2 Query: 80 MNQFRLKQIHAFTLRNGTDFSSFLITKLLETTDLPYARRVFDNTPDPNVCVYNKLIQA*S 259 MNQ LKQIHA++LRNG D + FLI KLL+ DLPYA +FD P P+V +YNK IQ S Sbjct: 1 MNQ--LKQIHAYSLRNGLDHTKFLIEKLLQLPDLPYACTLFDQIPKPSVYLYNKFIQTFS 58 Query: 260 S*GSPLQSLFLSVQM 304 S G P + L QM Sbjct: 59 SIGHPHRCWLLYCQM 73 >ref|XP_004142577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Cucumis sativus] Length = 589 Score = 76.6 bits (187), Expect = 2e-12 Identities = 42/75 (56%), Positives = 50/75 (66%) Frame = +2 Query: 80 MNQFRLKQIHAFTLRNGTDFSSFLITKLLETTDLPYARRVFDNTPDPNVCVYNKLIQA*S 259 MNQ LKQIHA++LRNG D + FLI KLL+ DLPYA +FD P P+V +YNK IQ S Sbjct: 1 MNQ--LKQIHAYSLRNGLDHTKFLIEKLLQLPDLPYACTLFDQIPKPSVYLYNKFIQTFS 58 Query: 260 S*GSPLQSLFLSVQM 304 S G P + L QM Sbjct: 59 SIGHPHRCWLLYCQM 73 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Vitis vinifera] Length = 512 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/74 (51%), Positives = 47/74 (63%) Frame = +2 Query: 92 RLKQIHAFTLRNGTDFSSFLITKLLETTDLPYARRVFDNTPDPNVCVYNKLIQA*SS*GS 271 RLKQI A+TLRNG + + LI LL+ +PYA ++FD P P V +YNKLIQA SS G Sbjct: 3 RLKQIQAYTLRNGIEHTKQLIVSLLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSHGP 62 Query: 272 PLQSLFLSVQMRLK 313 Q L QM L+ Sbjct: 63 HHQCFSLYTQMCLQ 76 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/74 (51%), Positives = 47/74 (63%) Frame = +2 Query: 92 RLKQIHAFTLRNGTDFSSFLITKLLETTDLPYARRVFDNTPDPNVCVYNKLIQA*SS*GS 271 RLKQI A+TLRNG + + LI LL+ +PYA ++FD P P V +YNKLIQA SS G Sbjct: 3 RLKQIQAYTLRNGIEHTKQLIVSLLQIPSIPYAHKLFDFIPKPTVFLYNKLIQAYSSHGP 62 Query: 272 PLQSLFLSVQMRLK 313 Q L QM L+ Sbjct: 63 HHQCFSLYTQMCLQ 76 >ref|XP_002523296.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537384|gb|EEF39012.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 353 Score = 68.2 bits (165), Expect = 7e-10 Identities = 37/76 (48%), Positives = 49/76 (64%) Frame = +2 Query: 80 MNQFRLKQIHAFTLRNGTDFSSFLITKLLETTDLPYARRVFDNTPDPNVCVYNKLIQA*S 259 MNQ LKQIHA+TLRNG D++ L +L++ ++PYA ++ D P PNV +YNKLIQA S Sbjct: 1 MNQ--LKQIHAYTLRNGIDYNKTLTERLIQIPNVPYAHKLIDLIPSPNVFLYNKLIQAYS 58 Query: 260 S*GSPLQSLFLSVQMR 307 Q + QMR Sbjct: 59 FQNQLHQCFSIYSQMR 74