BLASTX nr result
ID: Cephaelis21_contig00030702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030702 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525970.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002525970.1| conserved hypothetical protein [Ricinus communis] gi|223534702|gb|EEF36394.1| conserved hypothetical protein [Ricinus communis] Length = 1446 Score = 55.5 bits (132), Expect = 5e-06 Identities = 19/42 (45%), Positives = 28/42 (66%) Frame = +3 Query: 18 VHILHNKLCKERKCNCNRLRACISHYENCCYNSCKICKPVRE 143 V+ LH+ CK+R C C A +SH++ CCY +C IC P+R+ Sbjct: 422 VNYLHSTFCKDRSCKCRHFCALLSHFDKCCYANCDICGPLRD 463