BLASTX nr result
ID: Cephaelis21_contig00030631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030631 (760 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526943.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 >ref|XP_002526943.1| conserved hypothetical protein [Ricinus communis] gi|223533695|gb|EEF35430.1| conserved hypothetical protein [Ricinus communis] Length = 76 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 296 GCNNNCDIACCYCDIRKHPPLCVQCCKERP 207 GCNN+CD ACC CDI+K PPLCVQCCKE P Sbjct: 47 GCNNDCDTACCNCDIQKQPPLCVQCCKEDP 76