BLASTX nr result
ID: Cephaelis21_contig00030562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030562 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610649.1| GPCR-type G protein [Medicago truncatula] gi... 66 4e-09 gb|AFW59346.1| hypothetical protein ZEAMMB73_364791 [Zea mays] 65 8e-09 gb|AFW59345.1| hypothetical protein ZEAMMB73_364791 [Zea mays] 65 8e-09 gb|AFW59343.1| hypothetical protein ZEAMMB73_364791 [Zea mays] 65 8e-09 gb|AFK49515.1| unknown [Lotus japonicus] 65 8e-09 >ref|XP_003610649.1| GPCR-type G protein [Medicago truncatula] gi|355511984|gb|AES93607.1| GPCR-type G protein [Medicago truncatula] Length = 489 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 583 AAAYSRTWKGHMQNLLGYALSVYCVYKMIKVWETLI 476 AAAYSRTWKGHMQNLLGYA SVYCVYKMIK ++++ Sbjct: 283 AAAYSRTWKGHMQNLLGYACSVYCVYKMIKSLQSVV 318 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 99 VFWQAGSIDPVTLTISIFLQYFDIGINATLLSQ 1 VF QAGS+DPVT ISIFLQ+FDIGINA LLSQ Sbjct: 318 VFKQAGSVDPVTRMISIFLQFFDIGINAALLSQ 350 >gb|AFW59346.1| hypothetical protein ZEAMMB73_364791 [Zea mays] Length = 468 Score = 65.1 bits (157), Expect = 8e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 583 AAAYSRTWKGHMQNLLGYALSVYCVYKMIKVWETLI 476 AAAYSRTW+GH+QNLLGYALSVYCVYKM+K ++++ Sbjct: 283 AAAYSRTWRGHLQNLLGYALSVYCVYKMLKSLQSVV 318 >gb|AFW59345.1| hypothetical protein ZEAMMB73_364791 [Zea mays] Length = 428 Score = 65.1 bits (157), Expect = 8e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 583 AAAYSRTWKGHMQNLLGYALSVYCVYKMIKVWETLI 476 AAAYSRTW+GH+QNLLGYALSVYCVYKM+K ++++ Sbjct: 283 AAAYSRTWRGHLQNLLGYALSVYCVYKMLKSLQSVV 318 >gb|AFW59343.1| hypothetical protein ZEAMMB73_364791 [Zea mays] Length = 484 Score = 65.1 bits (157), Expect = 8e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 583 AAAYSRTWKGHMQNLLGYALSVYCVYKMIKVWETLI 476 AAAYSRTW+GH+QNLLGYALSVYCVYKM+K ++++ Sbjct: 299 AAAYSRTWRGHLQNLLGYALSVYCVYKMLKSLQSVV 334 >gb|AFK49515.1| unknown [Lotus japonicus] Length = 467 Score = 65.1 bits (157), Expect = 8e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 583 AAAYSRTWKGHMQNLLGYALSVYCVYKMIKVWETLI 476 AAAYSRTW+GHMQNLLGYA SVYCVYKMIK ++++ Sbjct: 282 AAAYSRTWRGHMQNLLGYACSVYCVYKMIKSLQSVV 317 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 99 VFWQAGSIDPVTLTISIFLQYFDIGINATLLSQ 1 VF Q GS+DPVT TISIFLQ+FDIGINA LLSQ Sbjct: 317 VFKQNGSVDPVTRTISIFLQFFDIGINAALLSQ 349