BLASTX nr result
ID: Cephaelis21_contig00030478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030478 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40917.3| unnamed protein product [Vitis vinifera] 79 3e-13 ref|XP_002301822.1| predicted protein [Populus trichocarpa] gi|2... 74 9e-12 ref|XP_003520997.1| PREDICTED: uncharacterized protein LOC100798... 72 6e-11 ref|XP_002527248.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 ref|XP_003626873.1| hypothetical protein MTR_8g011480 [Medicago ... 69 4e-10 >emb|CBI40917.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/61 (60%), Positives = 51/61 (83%), Gaps = 1/61 (1%) Frame = -2 Query: 183 RGETWQKANQIRDKFEYDREQRMREKAFAPMSGG-NDFTNDFPTKNQPFNAQRYISESES 7 +G++W++ +QIRDKFEYDRE+RMREKAFAPM+GG ++ ++NQ F+AQRY S+SES Sbjct: 50 QGDSWERVSQIRDKFEYDRERRMREKAFAPMTGGMAPGSHQSVSRNQRFDAQRYFSQSES 109 Query: 6 E 4 E Sbjct: 110 E 110 >ref|XP_002301822.1| predicted protein [Populus trichocarpa] gi|222843548|gb|EEE81095.1| predicted protein [Populus trichocarpa] Length = 233 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = -2 Query: 183 RGETWQKANQIRDKFEYDREQRMREKAFAPMSGGNDFTNDFP---TKNQPFNAQRYISE 16 +G+TW+K QIRDKFEYDRE+RMREKAFAPM+ G F + P T+N+PF+ QRY + Sbjct: 173 QGDTWEKVGQIRDKFEYDREKRMREKAFAPMNRGTSF--ELPHSNTQNRPFDTQRYFPD 229 >ref|XP_003520997.1| PREDICTED: uncharacterized protein LOC100798650 [Glycine max] Length = 230 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/59 (55%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -2 Query: 183 RGETWQKANQIRDKFEYDREQRMREKAFAPMSGGN-DFTNDFPTKNQPFNAQRYISESE 10 + + W+K N +RDKFEYDRE+RMREKAFAPM GG+ ++D NQP N RY S++E Sbjct: 170 QSDNWEKVNLLRDKFEYDRERRMREKAFAPMHGGSVPDSHDSDRWNQPLNTDRYFSQTE 228 >ref|XP_002527248.1| conserved hypothetical protein [Ricinus communis] gi|223533341|gb|EEF35092.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = -2 Query: 183 RGETWQKANQIRDKFEYDREQRMREKAFAPMSGGNDFTNDFPTKNQPFNAQRY 25 +G+TW+K +QIRDKFEYDRE+RMREKAFAPM+ G + D +NQP +A+RY Sbjct: 172 QGDTWEKVSQIRDKFEYDREKRMREKAFAPMNRGMELP-DPNFQNQPLDARRY 223 >ref|XP_003626873.1| hypothetical protein MTR_8g011480 [Medicago truncatula] gi|355520895|gb|AET01349.1| hypothetical protein MTR_8g011480 [Medicago truncatula] Length = 242 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -2 Query: 183 RGETWQKANQIRDKFEYDREQRMREKAFAPMSGGN-DFTNDFPTKNQPFNAQRYISESE 10 + +T +K N IRDKFEYDRE+RMREKAFAPM GG+ ++D NQP N RY S++E Sbjct: 176 KSDTLEKVNLIRDKFEYDRERRMREKAFAPMHGGSVADSHDSEGWNQPLNTDRYFSQTE 234