BLASTX nr result
ID: Cephaelis21_contig00030405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030405 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510549.1| Zeamatin precursor, putative [Ricinus commun... 62 1e-07 emb|CBI19884.3| unnamed protein product [Vitis vinifera] 59 7e-07 gb|AEV57472.1| thaumatin-like protein 3, partial [Prunus persica] 58 2e-06 ref|XP_003540838.1| PREDICTED: thaumatin-like protein-like [Glyc... 58 2e-06 gb|ACE80963.1| putative allergen Pru p 2.04 [Prunus dulcis x Pru... 58 2e-06 >ref|XP_002510549.1| Zeamatin precursor, putative [Ricinus communis] gi|223551250|gb|EEF52736.1| Zeamatin precursor, putative [Ricinus communis] Length = 325 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -3 Query: 153 MSSIFNSLRTLCSIFILLISTQGISGTTFTLINRCNHVVWPGILANAGSP 4 M S F++ ++ L+ +G+SG TFTLINRC + VWPGILANAGSP Sbjct: 1 MDSFFSTSALYITLITLIAFCRGVSGATFTLINRCGYTVWPGILANAGSP 50 >emb|CBI19884.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = -3 Query: 153 MSSIFNSLRTLCSIFILLISTQGISGTTFTLINRCNHVVWPGILANAGS 7 M+ IF+ + CS +L + +G+SGTTF + NRC+ VWPGIL+NAGS Sbjct: 1 MNPIFSCFFSRCSALVLTLLLRGVSGTTFAITNRCDFTVWPGILSNAGS 49 >gb|AEV57472.1| thaumatin-like protein 3, partial [Prunus persica] Length = 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -3 Query: 162 LLPMSSIFNSLRTLCSIFILLISTQGISGTTFTLINRCNHVVWPGILANAGSPP 1 + P++S+ SL T+ +F T G+ TTFT++N+C + VWPGIL NAG PP Sbjct: 1 MAPLASLLVSLLTILGLF-----TSGVLSTTFTMVNKCEYTVWPGILTNAGVPP 49 >ref|XP_003540838.1| PREDICTED: thaumatin-like protein-like [Glycine max] Length = 346 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -3 Query: 114 IFILLISTQGISGTTFTLINRCNHVVWPGILANAGSPP 1 I +LL++ +G+ G TFT N+C++ VWPGILANAGSPP Sbjct: 12 IALLLLTPKGVMGATFTFFNKCDYTVWPGILANAGSPP 49 >gb|ACE80963.1| putative allergen Pru p 2.04 [Prunus dulcis x Prunus persica] Length = 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -3 Query: 162 LLPMSSIFNSLRTLCSIFILLISTQGISGTTFTLINRCNHVVWPGILANAGSPP 1 + P++S+ SL T+ +F T G+ TTFT++N+C + VWPGIL NAG PP Sbjct: 1 MAPLASLLVSLLTILGLF-----TSGVLSTTFTMVNKCEYTVWPGILTNAGVPP 49