BLASTX nr result
ID: Cephaelis21_contig00030211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030211 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago ... 81 8e-14 ref|XP_003628428.1| Leucine-rich repeat family protein /protein ... 81 8e-14 ref|XP_003519558.1| PREDICTED: probable LRR receptor-like serine... 76 2e-12 gb|AFW71210.1| hypothetical protein ZEAMMB73_005868, partial [Ze... 74 2e-11 gb|AEO14875.1| rfls6 protein [Glycine max] 72 6e-11 >ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago truncatula] gi|355522454|gb|AET02908.1| hypothetical protein MTR_8g058070 [Medicago truncatula] Length = 117 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/58 (60%), Positives = 42/58 (72%) Frame = +1 Query: 253 VSALKEITATLGKRDWDFSVDPCSGLNNWVVPNTTGETRNAVICDCSFDNNAVFHVIS 426 V ALK+I TLGK+DWDFSVDPCSG NNW+ + NAV C+CSF NN + HV+S Sbjct: 33 VEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNCSFQNNTLCHVVS 90 >ref|XP_003628428.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355522450|gb|AET02904.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 116 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/58 (60%), Positives = 42/58 (72%) Frame = +1 Query: 253 VSALKEITATLGKRDWDFSVDPCSGLNNWVVPNTTGETRNAVICDCSFDNNAVFHVIS 426 V ALK+I TLGK+DWDFSVDPCSG NNW+ + NAV C+CSF NN + HV+S Sbjct: 33 VEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNCSFQNNTLCHVVS 90 >ref|XP_003519558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Glycine max] Length = 1025 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/58 (56%), Positives = 42/58 (72%) Frame = +1 Query: 253 VSALKEITATLGKRDWDFSVDPCSGLNNWVVPNTTGETRNAVICDCSFDNNAVFHVIS 426 V ALKEI + +GK+DWDF VDPCSG NW V + ++VICDCSFD+N+ HV+S Sbjct: 41 VKALKEIGSKIGKKDWDFGVDPCSGKGNWNVSDARKGFESSVICDCSFDHNSSCHVVS 98 >gb|AFW71210.1| hypothetical protein ZEAMMB73_005868, partial [Zea mays] Length = 308 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/58 (62%), Positives = 39/58 (67%) Frame = +1 Query: 253 VSALKEITATLGKRDWDFSVDPCSGLNNWVVPNTTGETRNAVICDCSFDNNAVFHVIS 426 V ALK I L K DWDFSVDPCSGL NWV N TG + V CDCSF+N+ HVIS Sbjct: 40 VEALKGIACKLNKADWDFSVDPCSGLGNWV--NVTGLLSSNVTCDCSFNNHTECHVIS 95 >gb|AEO14875.1| rfls6 protein [Glycine max] Length = 1027 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 253 VSALKEITATLGKRDWDFSVDPCSGLNNWVVPNT-TGETRNAVICDCSFDNNAVFHVIS 426 V ALKEI + +GK+DW+F VDPCSG NW VP+ ++VICDCSF++N+ HV+S Sbjct: 40 VKALKEIGSKIGKKDWNFGVDPCSGKGNWNVPDARKAFVMSSVICDCSFNHNSSCHVVS 98