BLASTX nr result
ID: Cephaelis21_contig00030196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030196 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147342.1| PREDICTED: psbP domain-containing protein 2,... 55 6e-06 >ref|XP_004147342.1| PREDICTED: psbP domain-containing protein 2, chloroplastic-like [Cucumis sativus] gi|449523543|ref|XP_004168783.1| PREDICTED: psbP domain-containing protein 2, chloroplastic-like [Cucumis sativus] Length = 357 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = +3 Query: 120 DFKKSIALSRRLLFRFSIHVPVLLWNPFSSSLSMATTNDVLSLQRYTDSKEGFTLLRPTS 299 + K ++ SRR + ++ + L + FS+S+S A + L+RYTDSKEGFTLLRP+S Sbjct: 160 EHKFALVTSRRAM---NVSILSLFFYGFSTSISSAVFAEDFELERYTDSKEGFTLLRPSS 216 Query: 300 WIQV 311 W++V Sbjct: 217 WVKV 220