BLASTX nr result
ID: Cephaelis21_contig00030176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030176 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515928.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002515928.1| conserved hypothetical protein [Ricinus communis] gi|223544833|gb|EEF46348.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/65 (44%), Positives = 37/65 (56%), Gaps = 5/65 (7%) Frame = +2 Query: 116 SFRSMVLTIVLLAFVVSPMLMPQSEATGMPARGLLQR-----CPNCRCCGAPPRGERCCR 280 S +S ++T+ + A V+SPM+ SEA M R LLQ CP C CC PP G+ CC Sbjct: 5 SLKSFLVTLFIFAMVLSPMI--PSEAARMNQRDLLQTNEPIFCPACVCCSPPPPGQ-CCD 61 Query: 281 CCLNP 295 CC P Sbjct: 62 CCATP 66