BLASTX nr result
ID: Cephaelis21_contig00030078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030078 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81029.1| hypothetical protein VITISV_020535 [Vitis vinifera] 65 8e-09 ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinu... 64 2e-08 ref|XP_002308723.1| glutamate-gated kainate-type ion channel rec... 64 2e-08 ref|XP_002271672.2| PREDICTED: glutamate receptor 2.8-like [Viti... 63 2e-08 emb|CBI23997.3| unnamed protein product [Vitis vinifera] 63 2e-08 >emb|CAN81029.1| hypothetical protein VITISV_020535 [Vitis vinifera] Length = 971 Score = 64.7 bits (156), Expect = 8e-09 Identities = 36/75 (48%), Positives = 44/75 (58%) Frame = -1 Query: 227 GNLFVYKLNNAFRKVDIQLASMIAISTSAKDGEIMNELRNLMAKQTRVFLVHMNILLGHR 48 GN V L +A +VD + AI SA D +I+ EL LM TRVF+VHM LG + Sbjct: 180 GNGVVPSLTSALEEVDTHVTYRSAIHPSATDDQIVKELYKLMTMSTRVFIVHMLTPLGSQ 239 Query: 47 LLVLARKAGMMSEGY 3 L A+KAGMM EGY Sbjct: 240 LFTKAKKAGMMEEGY 254 >ref|XP_002515378.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223545322|gb|EEF46827.1| glutamate receptor 2 plant, putative [Ricinus communis] Length = 931 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = -1 Query: 206 LNNAFRKVDIQLASMIAISTSAKDGEIMNELRNLMAKQTRVFLVHMNILLGHRLLVLARK 27 L +A + +D ++ IS SA D +I EL LM+ QTRVF++HM LG RLL AR+ Sbjct: 161 LTDALQAIDARIPYRSLISFSATDDQIAEELYKLMSMQTRVFILHMLPSLGSRLLTKARE 220 Query: 26 AGMMSEGY 3 GMMSEGY Sbjct: 221 VGMMSEGY 228 >ref|XP_002308723.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222854699|gb|EEE92246.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Length = 866 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/68 (50%), Positives = 44/68 (64%) Frame = -1 Query: 206 LNNAFRKVDIQLASMIAISTSAKDGEIMNELRNLMAKQTRVFLVHMNILLGHRLLVLARK 27 L +A ++VD ++ IS SA D +I+ EL LM QTRVF+VHM LG RL A++ Sbjct: 165 LTDALQEVDARVPYRSVISPSATDDQIVEELYKLMTMQTRVFIVHMYPSLGTRLFTKAKE 224 Query: 26 AGMMSEGY 3 GMMSEGY Sbjct: 225 IGMMSEGY 232 >ref|XP_002271672.2| PREDICTED: glutamate receptor 2.8-like [Vitis vinifera] Length = 1270 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/75 (46%), Positives = 44/75 (58%) Frame = -1 Query: 227 GNLFVYKLNNAFRKVDIQLASMIAISTSAKDGEIMNELRNLMAKQTRVFLVHMNILLGHR 48 GN V L +A ++VD + AI SA D +I+ EL LM TRVF+VHM LG + Sbjct: 153 GNEVVPSLTSALQEVDTHVTYRSAIHPSATDDQIVKELYKLMTMSTRVFIVHMLTPLGSQ 212 Query: 47 LLVLARKAGMMSEGY 3 L A +AGMM EGY Sbjct: 213 LFTKANEAGMMEEGY 227 >emb|CBI23997.3| unnamed protein product [Vitis vinifera] Length = 1316 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/75 (46%), Positives = 44/75 (58%) Frame = -1 Query: 227 GNLFVYKLNNAFRKVDIQLASMIAISTSAKDGEIMNELRNLMAKQTRVFLVHMNILLGHR 48 GN V L +A ++VD + AI SA D +I+ EL LM TRVF+VHM LG + Sbjct: 153 GNEVVPSLTSALQEVDTHVTYRSAIHPSATDDQIVKELYKLMTMSTRVFIVHMLTPLGSQ 212 Query: 47 LLVLARKAGMMSEGY 3 L A +AGMM EGY Sbjct: 213 LFTKANEAGMMEEGY 227