BLASTX nr result
ID: Cephaelis21_contig00030025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030025 (638 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565078.1| uncharacterized protein [Arabidopsis thaliana] ... 56 6e-06 >ref|NP_565078.1| uncharacterized protein [Arabidopsis thaliana] gi|62319486|dbj|BAD94874.1| hypothetical protein [Arabidopsis thaliana] gi|89001015|gb|ABD59097.1| At1g74055 [Arabidopsis thaliana] gi|332197422|gb|AEE35543.1| uncharacterized protein [Arabidopsis thaliana] Length = 144 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 8/77 (10%) Frame = -2 Query: 388 PFVAVIFVLTFLAIVSCFIGRICKG--------RSVNPPQSIKHAGLLAWMRQKCCICAT 233 PF AVI VL LA++SCF+GR C VNP + IK GLL W+R+K C Sbjct: 54 PFFAVISVLIILAVLSCFLGRFCARSRQRTGLVAEVNPLEMIKSGGLLGWLRRKWRRCLA 113 Query: 232 NDAKVLADKGSAGQTET 182 D + A ET Sbjct: 114 GDVEAGAKVADCASKET 130