BLASTX nr result
ID: Cephaelis21_contig00030008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030008 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299253.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 emb|CAN84022.1| hypothetical protein VITISV_004991 [Vitis vinifera] 79 4e-13 ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat... 69 3e-10 ref|XP_003529187.1| PREDICTED: putative pentatricopeptide repeat... 68 7e-10 ref|NP_178983.1| pentatricopeptide repeat-containing protein [Ar... 67 1e-09 >ref|XP_002299253.1| predicted protein [Populus trichocarpa] gi|222846511|gb|EEE84058.1| predicted protein [Populus trichocarpa] Length = 599 Score = 84.0 bits (206), Expect = 1e-14 Identities = 43/71 (60%), Positives = 53/71 (74%) Frame = +1 Query: 10 AIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGLDVSVSNALV 189 AIGYF K S +F N YTFS VLKA +GL+D+ KG EVHS++ ++GF DV V+NALV Sbjct: 110 AIGYFCSMKDS-VFIYNKYTFSIVLKAFVGLLDLNKGKEVHSMVKQLGFESDVCVANALV 168 Query: 190 DLYSKCGKIRY 222 D+YSKCG I Y Sbjct: 169 DMYSKCGCIGY 179 >emb|CAN84022.1| hypothetical protein VITISV_004991 [Vitis vinifera] Length = 566 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/74 (51%), Positives = 51/74 (68%) Frame = +1 Query: 1 HDAAIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGLDVSVSN 180 H+ AIGYF+L ++ I N +TFS VLK C+GLMD KG EVH +I + G G VSV+N Sbjct: 107 HEEAIGYFSLMQELGIVA-NKFTFSIVLKQCVGLMDFNKGKEVHCVISRTGLGNVVSVAN 165 Query: 181 ALVDLYSKCGKIRY 222 + +D+Y KCG + Y Sbjct: 166 SXIDMYCKCGHVGY 179 >ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Vitis vinifera] Length = 686 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/69 (49%), Positives = 49/69 (71%) Frame = +1 Query: 4 DAAIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGLDVSVSNA 183 D AI ++ L + S+ F PNN+TF +VLKAC L+D+ G+++H+L+ K GF DV V + Sbjct: 94 DDAIEFYGLMR-SEGFLPNNFTFPFVLKACARLLDLQLGVKIHTLVVKGGFDCDVFVKTS 152 Query: 184 LVDLYSKCG 210 LV LY+KCG Sbjct: 153 LVCLYAKCG 161 >ref|XP_003529187.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Glycine max] Length = 780 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/69 (44%), Positives = 48/69 (69%) Frame = +1 Query: 10 AIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGLDVSVSNALV 189 A+ F +QS + PNN+TF+ VL+AC L+ + G ++HS + K+G +V VSNAL+ Sbjct: 290 ALELFCRMRQSSVVVPNNFTFASVLQACASLVLLNLGNQIHSCVLKVGLDSNVFVSNALM 349 Query: 190 DLYSKCGKI 216 D+Y+KCG+I Sbjct: 350 DVYAKCGEI 358 >ref|NP_178983.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206168|sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gi|4558664|gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana] gi|330251150|gb|AEC06244.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 697 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/71 (47%), Positives = 47/71 (66%) Frame = +1 Query: 4 DAAIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGLDVSVSNA 183 + A+ YF + + F N Y+F+ VL AC GL D+ KG++VHSLI K F DV + +A Sbjct: 134 EEALCYFAMMHKEG-FVLNEYSFASVLSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSA 192 Query: 184 LVDLYSKCGKI 216 LVD+YSKCG + Sbjct: 193 LVDMYSKCGNV 203 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 6/76 (7%) Frame = +1 Query: 1 HDAAIGYFTLFKQSKIFCPNNYTFSYVLKACLGLMDVCKGMEVHSLICKMGFGL------ 162 ++ A+ F L K+ + CP +Y+F+ +LKAC L ++ GM+ H + K GF Sbjct: 367 NEEALSLFCLLKRESV-CPTHYSFANILKACADLAELHLGMQAHVHVLKHGFKFQSGEED 425 Query: 163 DVSVSNALVDLYSKCG 210 D+ V N+L+D+Y KCG Sbjct: 426 DIFVGNSLIDMYVKCG 441