BLASTX nr result
ID: Cephaelis21_contig00030003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00030003 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140247.1| PREDICTED: probable LRR receptor-like serine... 90 2e-16 ref|XP_003519558.1| PREDICTED: probable LRR receptor-like serine... 89 3e-16 ref|XP_002306015.1| predicted protein [Populus trichocarpa] gi|2... 89 3e-16 ref|XP_003617471.1| BED finger-nbs resistance protein [Medicago ... 86 5e-15 ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [... 85 8e-15 >ref|XP_004140247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Cucumis sativus] gi|449481221|ref|XP_004156118.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Cucumis sativus] Length = 1028 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/62 (66%), Positives = 46/62 (74%) Frame = -3 Query: 194 RLDKREVSVLREIGKGLGKTDWDFSIDPCSGKGNWSRPILIKGIESSVTCDCSFNGNSTC 15 +L + EV L+EI K LGK DWDF+IDPCSG+G W KG ESSVTCDCSFN NSTC Sbjct: 37 KLHREEVKALKEIEKKLGKNDWDFNIDPCSGEGKWHVVNGRKGFESSVTCDCSFNHNSTC 96 Query: 14 HI 9 HI Sbjct: 97 HI 98 >ref|XP_003519558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Glycine max] Length = 1025 Score = 89.4 bits (220), Expect = 3e-16 Identities = 37/62 (59%), Positives = 47/62 (75%) Frame = -3 Query: 194 RLDKREVSVLREIGKGLGKTDWDFSIDPCSGKGNWSRPILIKGIESSVTCDCSFNGNSTC 15 +L+ +EV L+EIG +GK DWDF +DPCSGKGNW+ KG ESSV CDCSF+ NS+C Sbjct: 35 KLNTQEVKALKEIGSKIGKKDWDFGVDPCSGKGNWNVSDARKGFESSVICDCSFDHNSSC 94 Query: 14 HI 9 H+ Sbjct: 95 HV 96 >ref|XP_002306015.1| predicted protein [Populus trichocarpa] gi|222848979|gb|EEE86526.1| predicted protein [Populus trichocarpa] Length = 977 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -3 Query: 176 VSVLREIGKGLGKTDWDFSIDPCSGKGNWSRPILIKGIESSVTCDCSFNGNSTCHI 9 V VLREIGK LGK DWDF+ DPCSG+GNWS KG E+SVTCDCSFN NS+CH+ Sbjct: 1 VRVLREIGKKLGKKDWDFNKDPCSGEGNWSILDERKGFENSVTCDCSFNNNSSCHL 56 >ref|XP_003617471.1| BED finger-nbs resistance protein [Medicago truncatula] gi|355518806|gb|AET00430.1| BED finger-nbs resistance protein [Medicago truncatula] Length = 1039 Score = 85.5 bits (210), Expect = 5e-15 Identities = 35/62 (56%), Positives = 46/62 (74%) Frame = -3 Query: 194 RLDKREVSVLREIGKGLGKTDWDFSIDPCSGKGNWSRPILIKGIESSVTCDCSFNGNSTC 15 +L+ +EV L+EIG +GK DWDF +DPCSGKG W+ KG ES+V C+CSFN NS+C Sbjct: 30 KLNTQEVKALKEIGNKIGKKDWDFGVDPCSGKGKWNVSDSRKGFESAVICNCSFNHNSSC 89 Query: 14 HI 9 H+ Sbjct: 90 HV 91 >ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355518088|gb|AES99711.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 996 Score = 84.7 bits (208), Expect = 8e-15 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = -3 Query: 191 LDKREVSVLREIGKGLGKTDWDFSIDPCSGKGNWSRPILIKGIESSVTCDCSFNGNSTCH 12 L K EV VL++I K LGK DWDFS+DPCSG+ NW+ + +KG E++VTC+C+F + CH Sbjct: 28 LSKDEVEVLKDIAKTLGKKDWDFSVDPCSGERNWTSSVQVKGSENAVTCNCTFVNATVCH 87 Query: 11 IT 6 +T Sbjct: 88 VT 89