BLASTX nr result
ID: Cephaelis21_contig00027910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027910 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530159.1| conserved hypothetical protein [Ricinus comm... 84 9e-15 ref|XP_002523863.1| hypothetical protein RCOM_1282480 [Ricinus c... 84 2e-14 ref|XP_003535805.1| PREDICTED: uncharacterized protein LOC100786... 83 3e-14 ref|XP_003519129.1| PREDICTED: uncharacterized protein LOC100818... 83 3e-14 ref|XP_003635863.1| hypothetical protein MTR_013s0006 [Medicago ... 82 6e-14 >ref|XP_002530159.1| conserved hypothetical protein [Ricinus communis] gi|223530320|gb|EEF32214.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 338 RQSMLQMILEKEIFSKDDLQELLNCFLQLNSSSHHRTIVQAFMDVWNGVISKK 180 R SMLQMILEKEI+SKDDL+ELLNCFLQLNS HH IV+AF ++WNGV S K Sbjct: 128 RHSMLQMILEKEIYSKDDLKELLNCFLQLNSPYHHGIIVRAFTEIWNGVYSVK 180 >ref|XP_002523863.1| hypothetical protein RCOM_1282480 [Ricinus communis] gi|223536951|gb|EEF38589.1| hypothetical protein RCOM_1282480 [Ricinus communis] Length = 175 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -1 Query: 338 RQSMLQMILEKEIFSKDDLQELLNCFLQLNSSSHHRTIVQAFMDVWNGVISKKPED 171 + SMLQMI EKEI+S DDLQELLNCFL+LNS HH IVQAF ++WN VISKK D Sbjct: 111 KHSMLQMIFEKEIYSADDLQELLNCFLKLNSPRHHGLIVQAFTEIWNDVISKKLMD 166 >ref|XP_003535805.1| PREDICTED: uncharacterized protein LOC100786450 [Glycine max] Length = 177 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/57 (66%), Positives = 45/57 (78%) Frame = -1 Query: 338 RQSMLQMILEKEIFSKDDLQELLNCFLQLNSSSHHRTIVQAFMDVWNGVISKKPEDG 168 R SMLQMILE EI+SK+DL+ELLNCFLQLNS HH IV+AF ++WNGV S + G Sbjct: 107 RHSMLQMILENEIYSKEDLRELLNCFLQLNSPDHHGVIVRAFTEIWNGVFSVRRRSG 163 >ref|XP_003519129.1| PREDICTED: uncharacterized protein LOC100818531 [Glycine max] Length = 169 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -1 Query: 338 RQSMLQMILEKEIFSKDDLQELLNCFLQLNSSSHHRTIVQAFMDVWNGVIS 186 R SMLQMILE EI+SKDDL+ELLNCFLQLNS HH IV+AF ++WNGV S Sbjct: 100 RHSMLQMILENEIYSKDDLRELLNCFLQLNSPDHHGVIVRAFTEIWNGVFS 150 >ref|XP_003635863.1| hypothetical protein MTR_013s0006 [Medicago truncatula] gi|355501798|gb|AES83001.1| hypothetical protein MTR_013s0006 [Medicago truncatula] Length = 199 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = -1 Query: 338 RQSMLQMILEKEIFSKDDLQELLNCFLQLNSSSHHRTIVQAFMDVWNGVISKKPEDGHHH 159 R SMLQMILE EI+SKDDL+ELLNCFLQLN+ HH IV+AF ++WNGV +P H Sbjct: 126 RHSMLQMILENEIYSKDDLRELLNCFLQLNAPYHHGVIVRAFTEIWNGVSIMRPSSPSLH 185