BLASTX nr result
ID: Cephaelis21_contig00027807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027807 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB87911.1| F-box-containing protein 1 [Malus x domestica] 89 5e-16 ref|XP_002262830.2| PREDICTED: insulin-like growth factor-bindin... 88 6e-16 ref|XP_003549716.1| PREDICTED: F-box/LRR-repeat protein 14-like ... 86 3e-15 ref|XP_002517700.1| F-box/LRR-repeat protein, putative [Ricinus ... 84 9e-15 ref|XP_002270172.1| PREDICTED: F-box/LRR-repeat protein 14 [Viti... 84 1e-14 >gb|ACB87911.1| F-box-containing protein 1 [Malus x domestica] Length = 580 Score = 88.6 bits (218), Expect = 5e-16 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = -1 Query: 351 GLIGLVSLNVSSSRITNDGLEFLKPLKNLTSLYLDFCNVTGSEIKKLQSKHLPNLVTFRP 172 GL LVSLNVS+SRITN+GL+ LKPLKNL SL L+ C VT SEI+KLQS LPNLV+FRP Sbjct: 520 GLTALVSLNVSNSRITNEGLQHLKPLKNLRSLTLESCKVTASEIRKLQSDALPNLVSFRP 579 Query: 171 E 169 E Sbjct: 580 E 580 >ref|XP_002262830.2| PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit-like [Vitis vinifera] gi|296084545|emb|CBI25566.3| unnamed protein product [Vitis vinifera] Length = 578 Score = 88.2 bits (217), Expect = 6e-16 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = -1 Query: 351 GLIGLVSLNVSSSRITNDGLEFLKPLKNLTSLYLDFCNVTGSEIKKLQSKHLPNLVTFRP 172 GL LVSLNVS+SRITN+GL+ LKPLKNL SL L+ C VT SEI+KLQS LPNLV+FRP Sbjct: 518 GLTALVSLNVSNSRITNNGLQHLKPLKNLLSLSLESCKVTASEIRKLQSTALPNLVSFRP 577 Query: 171 E 169 E Sbjct: 578 E 578 >ref|XP_003549716.1| PREDICTED: F-box/LRR-repeat protein 14-like [Glycine max] Length = 580 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/61 (68%), Positives = 50/61 (81%) Frame = -1 Query: 351 GLIGLVSLNVSSSRITNDGLEFLKPLKNLTSLYLDFCNVTGSEIKKLQSKHLPNLVTFRP 172 G+ L SLNVS+SRITN+GL +LKPLKNL +L L+ C VT SEIKKLQS LPNL++FRP Sbjct: 520 GMTALRSLNVSNSRITNEGLRYLKPLKNLRTLTLESCKVTASEIKKLQSTDLPNLISFRP 579 Query: 171 E 169 E Sbjct: 580 E 580 >ref|XP_002517700.1| F-box/LRR-repeat protein, putative [Ricinus communis] gi|223543332|gb|EEF44864.1| F-box/LRR-repeat protein, putative [Ricinus communis] Length = 529 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -1 Query: 351 GLIGLVSLNVSSSRITNDGLEFLKPLKNLTSLYLDFCNVTGSEIKKLQSKHLPNLVTFRP 172 GL GLVSLNVS+SRIT+ GL+ LKPLKNL SL L+ C VT ++IKKLQS LP LV+FRP Sbjct: 469 GLTGLVSLNVSNSRITSAGLQHLKPLKNLKSLTLESCKVTATDIKKLQSTDLPQLVSFRP 528 Query: 171 E 169 E Sbjct: 529 E 529 >ref|XP_002270172.1| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera] gi|297743556|emb|CBI36423.3| unnamed protein product [Vitis vinifera] Length = 578 Score = 84.0 bits (206), Expect = 1e-14 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = -1 Query: 351 GLIGLVSLNVSSSRITNDGLEFLKPLKNLTSLYLDFCNVTGSEIKKLQSKHLPNLVTFRP 172 GL LVSL+VS+SRITN GL+ LK LKNL SL LD C VT ++IKKLQSK LPNLV+FRP Sbjct: 518 GLTALVSLSVSNSRITNAGLQHLKQLKNLKSLTLDSCKVTVNDIKKLQSKDLPNLVSFRP 577 Query: 171 E 169 E Sbjct: 578 E 578