BLASTX nr result
ID: Cephaelis21_contig00027745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027745 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana] 92 4e-17 gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana] 92 4e-17 ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis t... 92 4e-17 ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis t... 92 6e-17 ref|XP_002285238.1| PREDICTED: putative phagocytic receptor 1b [... 91 1e-16 >gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana] Length = 260 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/71 (60%), Positives = 52/71 (73%), Gaps = 5/71 (7%) Frame = +2 Query: 23 TILIFVGVF-----GQVRSEAFNHKYKIGDLVPFYANKIGPFHNPSETYAYYEFPFCRPA 187 TIL+ VG G VRS+A +H+YK GD VP YANK+GPFHNPSETY Y++ PFC P Sbjct: 6 TILLLVGAILFSGAGYVRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPE 65 Query: 188 RWQEKKESLGE 220 +EKKE+LGE Sbjct: 66 GVKEKKEALGE 76 >gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana] Length = 546 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/71 (60%), Positives = 52/71 (73%), Gaps = 5/71 (7%) Frame = +2 Query: 23 TILIFVGVF-----GQVRSEAFNHKYKIGDLVPFYANKIGPFHNPSETYAYYEFPFCRPA 187 TIL+ VG G VRS+A +H+YK GD VP YANK+GPFHNPSETY Y++ PFC P Sbjct: 6 TILLLVGAILFSGAGYVRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPE 65 Query: 188 RWQEKKESLGE 220 +EKKE+LGE Sbjct: 66 GVKEKKEALGE 76 >ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana] gi|15450755|gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana] gi|20334722|gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana] gi|332191079|gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana] Length = 592 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/71 (60%), Positives = 52/71 (73%), Gaps = 5/71 (7%) Frame = +2 Query: 23 TILIFVGVF-----GQVRSEAFNHKYKIGDLVPFYANKIGPFHNPSETYAYYEFPFCRPA 187 TIL+ VG G VRS+A +H+YK GD VP YANK+GPFHNPSETY Y++ PFC P Sbjct: 6 TILLLVGAILFSGAGYVRSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPE 65 Query: 188 RWQEKKESLGE 220 +EKKE+LGE Sbjct: 66 GVKEKKEALGE 76 >ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana] gi|4406780|gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana] gi|16604501|gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana] gi|110741070|dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana] gi|330250434|gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana] Length = 592 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/71 (57%), Positives = 53/71 (74%), Gaps = 5/71 (7%) Frame = +2 Query: 23 TILIFVGVF-----GQVRSEAFNHKYKIGDLVPFYANKIGPFHNPSETYAYYEFPFCRPA 187 T+L+F+G G VRS+A +H+YK GD VP YANK+GPFHNPSETY Y++ PFC P Sbjct: 6 TLLLFIGALIFSGAGTVRSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPE 65 Query: 188 RWQEKKESLGE 220 ++KKE+LGE Sbjct: 66 GVKDKKEALGE 76 >ref|XP_002285238.1| PREDICTED: putative phagocytic receptor 1b [Vitis vinifera] gi|297737561|emb|CBI26762.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = +2 Query: 53 QVRSEAFNHKYKIGDLVPFYANKIGPFHNPSETYAYYEFPFCRPARWQEKKESLGE 220 QVRS+A +H+YK G+ VP YANK+GPFHNPSETY Y++ PFC PA +EKKE+LGE Sbjct: 20 QVRSDASSHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCVPAHLKEKKEALGE 75