BLASTX nr result
ID: Cephaelis21_contig00027725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027725 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526942.1| ATP synthase mitochondrial F1 complex assemb... 65 7e-09 ref|XP_002268368.1| PREDICTED: ATP synthase mitochondrial F1 com... 63 3e-08 ref|XP_003547684.1| PREDICTED: ATP synthase mitochondrial F1 com... 62 5e-08 ref|XP_002300073.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 gb|ABK96051.1| unknown [Populus trichocarpa] 62 6e-08 >ref|XP_002526942.1| ATP synthase mitochondrial F1 complex assembly factor 2, mitochondrial precursor, putative [Ricinus communis] gi|223533694|gb|EEF35429.1| ATP synthase mitochondrial F1 complex assembly factor 2, mitochondrial precursor, putative [Ricinus communis] Length = 334 Score = 64.7 bits (156), Expect = 7e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 237 LKVDRWGLVEGGHDVDIADFRV*VSSAAVFLGLSR 133 L+VDRWGLVEGGHD+DIAD RV +SSAAVFLGLSR Sbjct: 299 LQVDRWGLVEGGHDIDIADLRVQISSAAVFLGLSR 333 >ref|XP_002268368.1| PREDICTED: ATP synthase mitochondrial F1 complex assembly factor 2 [Vitis vinifera] gi|296081322|emb|CBI17704.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 237 LKVDRWGLVEGGHDVDIADFRV*VSSAAVFLGLSRR 130 L+VD+WGLVEGGHDVD+AD +V +SSAA FLGLSRR Sbjct: 292 LQVDKWGLVEGGHDVDVADLKVQISSAAAFLGLSRR 327 >ref|XP_003547684.1| PREDICTED: ATP synthase mitochondrial F1 complex assembly factor 2-like [Glycine max] Length = 326 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 234 KVDRWGLVEGGHDVDIADFRV*VSSAAVFLGLSR 133 +VDRWGLVEGGHDVDIAD RV VSSA VFLGLSR Sbjct: 291 QVDRWGLVEGGHDVDIADLRVQVSSAIVFLGLSR 324 >ref|XP_002300073.1| predicted protein [Populus trichocarpa] gi|222847331|gb|EEE84878.1| predicted protein [Populus trichocarpa] Length = 270 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 234 KVDRWGLVEGGHDVDIADFRV*VSSAAVFLGLSRR 130 +VD WGLVEGGHD+DIAD RV +SSAAVFLGLSR+ Sbjct: 236 QVDTWGLVEGGHDIDIADLRVQISSAAVFLGLSRK 270 >gb|ABK96051.1| unknown [Populus trichocarpa] Length = 330 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 234 KVDRWGLVEGGHDVDIADFRV*VSSAAVFLGLSRR 130 +VD WGLVEGGHD+DIAD RV +SSAAVFLGLSR+ Sbjct: 296 QVDTWGLVEGGHDIDIADLRVQISSAAVFLGLSRK 330