BLASTX nr result
ID: Cephaelis21_contig00027695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027695 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511380.1| conserved hypothetical protein [Ricinus comm... 75 7e-12 ref|XP_002866527.1| hypothetical protein ARALYDRAFT_332525 [Arab... 74 1e-11 ref|NP_201105.1| Mitochondrial import inner membrane translocase... 74 1e-11 ref|XP_004152481.1| PREDICTED: uncharacterized protein LOC101204... 73 3e-11 ref|XP_002321610.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 >ref|XP_002511380.1| conserved hypothetical protein [Ricinus communis] gi|223550495|gb|EEF51982.1| conserved hypothetical protein [Ricinus communis] Length = 201 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -2 Query: 225 VGAGSATSATFGLILPGSLLWRLRNVMLGSVLGAAVCFPLG 103 VGAGSAT+ATFG+ILPGSL WR+RNV+LGSV+GAA CFPLG Sbjct: 120 VGAGSATAATFGVILPGSLRWRVRNVLLGSVMGAAFCFPLG 160 >ref|XP_002866527.1| hypothetical protein ARALYDRAFT_332525 [Arabidopsis lyrata subsp. lyrata] gi|297312362|gb|EFH42786.1| hypothetical protein ARALYDRAFT_332525 [Arabidopsis lyrata subsp. lyrata] Length = 200 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 225 VGAGSATSATFGLILPGSLLWRLRNVMLGSVLGAAVCFPLGSL 97 VGAGSAT+A FGLI+PGSL WR RNV+LGSVLGA VCFPLG L Sbjct: 120 VGAGSATAAVFGLIMPGSLAWRARNVLLGSVLGATVCFPLGWL 162 >ref|NP_201105.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] gi|28393224|gb|AAO42042.1| unknown protein [Arabidopsis thaliana] gi|28973221|gb|AAO63935.1| unknown protein [Arabidopsis thaliana] gi|332010302|gb|AED97685.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] Length = 201 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 225 VGAGSATSATFGLILPGSLLWRLRNVMLGSVLGAAVCFPLG 103 VGAGSAT+A FGLI+PGSL WR RNV+LGSVLGA VCFPLG Sbjct: 120 VGAGSATAAVFGLIMPGSLAWRARNVLLGSVLGATVCFPLG 160 >ref|XP_004152481.1| PREDICTED: uncharacterized protein LOC101204093 [Cucumis sativus] gi|449487754|ref|XP_004157784.1| PREDICTED: uncharacterized protein LOC101230339 [Cucumis sativus] Length = 205 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 219 AGSATSATFGLILPGSLLWRLRNVMLGSVLGAAVCFPLGSLH 94 AGSAT+ATFGLILPGSL WR RNV +GSVLGAA CFPLG +H Sbjct: 122 AGSATAATFGLILPGSLKWRARNVAMGSVLGAAFCFPLGWIH 163 >ref|XP_002321610.1| predicted protein [Populus trichocarpa] gi|222868606|gb|EEF05737.1| predicted protein [Populus trichocarpa] Length = 197 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 225 VGAGSATSATFGLILPGSLLWRLRNVMLGSVLGAAVCFPLGSLH 94 VGAGSAT+ATFGLI+PGSL WR RNV+LG +GAA CFPLG +H Sbjct: 117 VGAGSATAATFGLIMPGSLRWRARNVLLGLFMGAAFCFPLGWIH 160