BLASTX nr result
ID: Cephaelis21_contig00027675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027675 (928 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308886.1| predicted protein [Populus trichocarpa] gi|2... 66 1e-08 ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808... 64 4e-08 ref|XP_002322621.1| predicted protein [Populus trichocarpa] gi|2... 60 9e-07 ref|XP_003625000.1| hypothetical protein MTR_7g089860 [Medicago ... 57 5e-06 >ref|XP_002308886.1| predicted protein [Populus trichocarpa] gi|222854862|gb|EEE92409.1| predicted protein [Populus trichocarpa] Length = 154 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 322 YISNPMKVKTSASQFRALVQELTGQDADMPDPARFPDSE 438 YISNPMK K SAS+FRALVQELTGQD+++PDP++F DS+ Sbjct: 35 YISNPMKFKASASEFRALVQELTGQDSELPDPSKFVDSD 73 >ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808231 [Glycine max] Length = 168 Score = 64.3 bits (155), Expect = 4e-08 Identities = 34/45 (75%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = +1 Query: 322 YISNPMKVKTSASQFRALVQELTGQDADM-PDPARF----PDSES 441 YISNPMK+KTSAS+FRALVQELTGQDA+ PDP+RF PDS S Sbjct: 36 YISNPMKIKTSASEFRALVQELTGQDAESPPDPSRFHGHHPDSSS 80 >ref|XP_002322621.1| predicted protein [Populus trichocarpa] gi|222867251|gb|EEF04382.1| predicted protein [Populus trichocarpa] Length = 156 Score = 59.7 bits (143), Expect = 9e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 322 YISNPMKVKTSASQFRALVQELTGQDADMPDPARFPDSE 438 YISNPMK K SAS FRALVQELTGQD+++PDP + D + Sbjct: 33 YISNPMKFKISASGFRALVQELTGQDSELPDPTKIVDDD 71 >ref|XP_003625000.1| hypothetical protein MTR_7g089860 [Medicago truncatula] gi|355500015|gb|AES81218.1| hypothetical protein MTR_7g089860 [Medicago truncatula] Length = 165 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +1 Query: 322 YISNPMKVKTSASQFRALVQELTGQDADM-PDPARFPD 432 YISNPMKVKTSAS+FRALVQELTGQ A+ P+P+RF + Sbjct: 46 YISNPMKVKTSASEFRALVQELTGQYAESPPNPSRFQE 83