BLASTX nr result
ID: Cephaelis21_contig00027563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027563 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30274.3| unnamed protein product [Vitis vinifera] 107 1e-21 ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein... 107 1e-21 ref|XP_003520688.1| PREDICTED: BTB/POZ domain-containing protein... 103 1e-20 ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FB... 101 7e-20 ref|XP_002534000.1| ubiquitin-protein ligase, putative [Ricinus ... 100 2e-19 >emb|CBI30274.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 107 bits (266), Expect = 1e-21 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = +2 Query: 5 CMNLVELSLVGCQLLNPESQDIISIGWPGLISIHLEDCGEVTTYGLPSLMNCRALEDLLL 184 C+NLVELSL+GC+LLN +SQ IIS GWPGL SIHLE+CGEVT G+ SL +C+ALEDLLL Sbjct: 847 CVNLVELSLLGCRLLNSDSQQIISCGWPGLTSIHLEECGEVTADGVISLFDCKALEDLLL 906 Query: 185 RHTGPG 202 RH GPG Sbjct: 907 RHNGPG 912 >ref|XP_002277002.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Vitis vinifera] Length = 980 Score = 107 bits (266), Expect = 1e-21 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = +2 Query: 5 CMNLVELSLVGCQLLNPESQDIISIGWPGLISIHLEDCGEVTTYGLPSLMNCRALEDLLL 184 C+NLVELSL+GC+LLN +SQ IIS GWPGL SIHLE+CGEVT G+ SL +C+ALEDLLL Sbjct: 817 CVNLVELSLLGCRLLNSDSQQIISCGWPGLTSIHLEECGEVTADGVISLFDCKALEDLLL 876 Query: 185 RHTGPG 202 RH GPG Sbjct: 877 RHNGPG 882 >ref|XP_003520688.1| PREDICTED: BTB/POZ domain-containing protein FBL11-like [Glycine max] Length = 982 Score = 103 bits (258), Expect = 1e-20 Identities = 45/66 (68%), Positives = 56/66 (84%) Frame = +2 Query: 5 CMNLVELSLVGCQLLNPESQDIISIGWPGLISIHLEDCGEVTTYGLPSLMNCRALEDLLL 184 C NL+ELSL+GC LL+P+S II+ GWPGL+SIHLEDCGEVT G +L++C+ALED+LL Sbjct: 822 CRNLLELSLLGCPLLDPDSLQIITCGWPGLVSIHLEDCGEVTANGASALLDCKALEDILL 881 Query: 185 RHTGPG 202 RH GPG Sbjct: 882 RHNGPG 887 >ref|XP_003625779.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] gi|355500794|gb|AES81997.1| LRR and BTB/POZ domain-containing protein FBL11 [Medicago truncatula] Length = 1039 Score = 101 bits (251), Expect = 7e-20 Identities = 46/66 (69%), Positives = 54/66 (81%) Frame = +2 Query: 5 CMNLVELSLVGCQLLNPESQDIISIGWPGLISIHLEDCGEVTTYGLPSLMNCRALEDLLL 184 C NLVELSL+GC LLN +SQ IIS WPGL+S+HLE+CGE+T G+ L+NCRALEDLLL Sbjct: 880 CRNLVELSLLGCPLLNSDSQQIISRAWPGLVSMHLEECGEITANGVSVLLNCRALEDLLL 939 Query: 185 RHTGPG 202 RH G G Sbjct: 940 RHNGLG 945 >ref|XP_002534000.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223526002|gb|EEF28381.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 846 Score = 99.8 bits (247), Expect = 2e-19 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = +2 Query: 8 MNLVELSLVGCQLLNPESQDIISIGWPGLISIHLEDCGEVTTYGLPSLMNCRALEDLLLR 187 +NLVE SLVGC+ L +S IIS GWPGLISIHLEDCGEVTT G+ SL NCRALED+LLR Sbjct: 623 VNLVEFSLVGCRHLTSDSLHIISHGWPGLISIHLEDCGEVTTTGVSSLFNCRALEDILLR 682 Query: 188 HTGPG 202 H G G Sbjct: 683 HNGRG 687