BLASTX nr result
ID: Cephaelis21_contig00027264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027264 (783 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234617.1| starch synthase IV [Solanum lycopersicum] gi... 57 6e-06 >ref|NP_001234617.1| starch synthase IV [Solanum lycopersicum] gi|247643234|gb|ACT09058.1| starch synthase IV precursor [Solanum lycopersicum] Length = 1001 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 662 SIIADAEDQLSSVHLEDLIGMIRNAQKNIHMLNQARIRA 778 S+ ++ E Q SSVHL+DLIGMIRNA+KNIH+LN+AR+ A Sbjct: 118 SVDSNEEGQPSSVHLKDLIGMIRNAEKNIHLLNEARVHA 156