BLASTX nr result
ID: Cephaelis21_contig00027193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027193 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO92982.1| putative AAA ATPase [Solanum tuberosum] 60 2e-07 gb|AAT38766.2| Polyprotein, putative [Solanum demissum] 60 2e-07 gb|AAT39939.2| ATPase protein, putative [Solanum demissum] 60 2e-07 gb|AAT38774.1| Putative acid phosphatase, identical [Solanum dem... 59 3e-07 gb|ABO93010.1| putative AAA ATPase [Solanum tuberosum] 58 7e-07 >gb|ABO92982.1| putative AAA ATPase [Solanum tuberosum] Length = 527 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 320 FVWTMYQNYFPRELRDQFSRYTKKLTRYFSPYIQITFSE 436 F+WTMYQNYFP ELR RYT KL YF PY+ I F E Sbjct: 18 FIWTMYQNYFPHELRGHIRRYTNKLVSYFYPYMHIIFYE 56 >gb|AAT38766.2| Polyprotein, putative [Solanum demissum] Length = 1355 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 320 FVWTMYQNYFPRELRDQFSRYTKKLTRYFSPYIQITFSE 436 F+WTMYQNYFP ELR RYT KL YF PY+ I F E Sbjct: 18 FIWTMYQNYFPHELRGHIRRYTDKLVSYFYPYMHIIFCE 56 >gb|AAT39939.2| ATPase protein, putative [Solanum demissum] Length = 510 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 320 FVWTMYQNYFPRELRDQFSRYTKKLTRYFSPYIQITFSE 436 F+WTMYQNYFP ELR RYT KL YF PY+ I F E Sbjct: 18 FIWTMYQNYFPHELRGHIRRYTNKLVSYFYPYMHIIFYE 56 >gb|AAT38774.1| Putative acid phosphatase, identical [Solanum demissum] Length = 376 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 320 FVWTMYQNYFPRELRDQFSRYTKKLTRYFSPYIQITFSE 436 F+WTMYQNYFP ELR RYT KL YF PY+ I F E Sbjct: 18 FIWTMYQNYFPHELRGHIRRYTDKLVSYFYPYMHIIFYE 56 >gb|ABO93010.1| putative AAA ATPase [Solanum tuberosum] Length = 568 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +2 Query: 320 FVWTMYQNYFPRELRDQFSRYTKKLTRYFSPYIQITFSE 436 F WTMYQNYFP ELR RYT KL YF PY+ I F E Sbjct: 59 FTWTMYQNYFPHELRGHIRRYTDKLVSYFYPYMHIIFYE 97