BLASTX nr result
ID: Cephaelis21_contig00025993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025993 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522633.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002522637.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002522633.1| conserved hypothetical protein [Ricinus communis] gi|223538109|gb|EEF39720.1| conserved hypothetical protein [Ricinus communis] Length = 239 Score = 55.8 bits (133), Expect = 3e-06 Identities = 42/86 (48%), Positives = 53/86 (61%), Gaps = 3/86 (3%) Frame = -1 Query: 266 GNVGFGRDGRFVGNVG---KGVLENGGNVAEPVGKFGRVVGSVGIEGIVCNSCRAASPTW 96 G+VG GR+G VGNVG G+L +GGNV FG++ G+ G GI C RAASPT Sbjct: 157 GSVGLGREGWVVGNVGCGRDGILGSGGNVG-----FGKL-GTEGNGGI-CKRFRAASPTS 209 Query: 95 MLENDKAMIKEKTMPTLNEVAMLVLE 18 M EN KA+ +KT +VAML L+ Sbjct: 210 MPENAKAI--KKTKRKFLKVAMLHLQ 233 >ref|XP_002522637.1| conserved hypothetical protein [Ricinus communis] gi|223538113|gb|EEF39724.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 54.7 bits (130), Expect = 8e-06 Identities = 37/87 (42%), Positives = 45/87 (51%), Gaps = 6/87 (6%) Frame = -1 Query: 269 GGNVGFGRDGRFVGNVGK------GVLENGGNVAEPVGKFGRVVGSVGIEGIVCNSCRAA 108 GG VG GR+G VG VG G+L NGG V GKFG +G +C+ RAA Sbjct: 35 GGIVGLGREGWIVGKVGNVGCGRVGILGNGGIVG--FGKFGTEG-----KGGICSRLRAA 87 Query: 107 SPTWMLENDKAMIKEKTMPTLNEVAML 27 +PT MLEND K + L E M+ Sbjct: 88 NPTSMLENDNTTKKAVRLKELKEAIMI 114