BLASTX nr result
ID: Cephaelis21_contig00025989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025989 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311607.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_002517202.1| Protein C9orf114, putative [Ricinus communis... 83 2e-14 ref|XP_002871878.1| hypothetical protein ARALYDRAFT_909964 [Arab... 82 5e-14 ref|NP_197431.2| uncharacterized protein [Arabidopsis thaliana] ... 82 7e-14 emb|CAN75987.1| hypothetical protein VITISV_012192 [Vitis vinifera] 81 1e-13 >ref|XP_002311607.1| predicted protein [Populus trichocarpa] gi|222851427|gb|EEE88974.1| predicted protein [Populus trichocarpa] Length = 366 Score = 84.3 bits (207), Expect = 1e-14 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 530 QGKDVRELFDLYLNTCPHQGSRTIRTEEAIFISLQYFQEPISRVVEK 390 +GK+VRE+FD YLNTCPHQGSRTIRTEEAIFISLQYFQEPI+R + + Sbjct: 317 KGKNVREVFDSYLNTCPHQGSRTIRTEEAIFISLQYFQEPINRALHR 363 >ref|XP_002517202.1| Protein C9orf114, putative [Ricinus communis] gi|223543837|gb|EEF45365.1| Protein C9orf114, putative [Ricinus communis] Length = 369 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = -1 Query: 530 QGKDVRELFDLYLNTCPHQGSRTIRTEEAIFISLQYFQEPISRVVEK 390 +GK+VRE+F+ YLNTCPHQGSRTIRTEEAIFISLQYFQEPI+R +++ Sbjct: 320 KGKNVREVFNSYLNTCPHQGSRTIRTEEAIFISLQYFQEPINRALQR 366 >ref|XP_002871878.1| hypothetical protein ARALYDRAFT_909964 [Arabidopsis lyrata subsp. lyrata] gi|297317715|gb|EFH48137.1| hypothetical protein ARALYDRAFT_909964 [Arabidopsis lyrata subsp. lyrata] Length = 381 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -1 Query: 530 QGKDVRELFDLYLNTCPHQGSRTIRTEEAIFISLQYFQEPISRVVEK 390 +GK+VR++F++YLNTCPHQGSRTIR EEA+FISLQYFQEPISR V + Sbjct: 334 KGKNVRDVFNIYLNTCPHQGSRTIRAEEAMFISLQYFQEPISRAVRR 380 >ref|NP_197431.2| uncharacterized protein [Arabidopsis thaliana] gi|45825145|gb|AAS77480.1| At5g19300 [Arabidopsis thaliana] gi|110741745|dbj|BAE98818.1| hypothetical protein [Arabidopsis thaliana] gi|332005299|gb|AED92682.1| uncharacterized protein [Arabidopsis thaliana] Length = 398 Score = 81.6 bits (200), Expect = 7e-14 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -1 Query: 530 QGKDVRELFDLYLNTCPHQGSRTIRTEEAIFISLQYFQEPISRVVEK 390 +GK+VR++F++YLNTCPHQGSRTIR EEA+FISLQYFQEPISR V + Sbjct: 351 KGKNVRDVFNVYLNTCPHQGSRTIRAEEAMFISLQYFQEPISRAVRR 397 >emb|CAN75987.1| hypothetical protein VITISV_012192 [Vitis vinifera] Length = 363 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -1 Query: 539 H*NQGKDVRELFDLYLNTCPHQGSRTIRTEEAIFISLQYFQEPISRVVEK 390 H +GK+VRE+FD YLNTCP+QGSRTIRTEEAI ISLQYFQEPI+R +++ Sbjct: 305 HSLKGKNVREIFDSYLNTCPNQGSRTIRTEEAILISLQYFQEPINRALQR 354