BLASTX nr result
ID: Cephaelis21_contig00025851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025851 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512996.1| Salt-tolerance protein, putative [Ricinus co... 86 3e-15 ref|XP_002313009.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_002306138.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_002267957.1| PREDICTED: salt tolerance protein [Vitis vin... 85 5e-15 ref|XP_003540963.1| PREDICTED: uncharacterized protein LOC100818... 85 7e-15 >ref|XP_002512996.1| Salt-tolerance protein, putative [Ricinus communis] gi|223548007|gb|EEF49499.1| Salt-tolerance protein, putative [Ricinus communis] Length = 212 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 128 AFFYCEVDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 244 AFFYCE+DGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE Sbjct: 64 AFFYCEIDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 102 >ref|XP_002313009.1| predicted protein [Populus trichocarpa] gi|222849417|gb|EEE86964.1| predicted protein [Populus trichocarpa] Length = 203 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 128 AFFYCEVDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 244 AFFYCE+DGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE Sbjct: 64 AFFYCEIDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 102 >ref|XP_002306138.1| predicted protein [Populus trichocarpa] gi|222849102|gb|EEE86649.1| predicted protein [Populus trichocarpa] Length = 203 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 128 AFFYCEVDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 244 AFFYCE+DGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE Sbjct: 64 AFFYCEIDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 102 >ref|XP_002267957.1| PREDICTED: salt tolerance protein [Vitis vinifera] gi|297744726|emb|CBI37988.3| unnamed protein product [Vitis vinifera] Length = 210 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +2 Query: 128 AFFYCEVDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 244 AFFYCEVDG+SLCLQCDMIVHVGGKRTHGRYLLLRQRVE Sbjct: 64 AFFYCEVDGTSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 102 >ref|XP_003540963.1| PREDICTED: uncharacterized protein LOC100818604 [Glycine max] Length = 212 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +2 Query: 128 AFFYCEVDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVE 244 AFFYCE+DGSSLCLQCDMIVHVGGKRTHGRYLLLRQRV+ Sbjct: 64 AFFYCEIDGSSLCLQCDMIVHVGGKRTHGRYLLLRQRVQ 102