BLASTX nr result
ID: Cephaelis21_contig00025706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025706 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152623.1| PREDICTED: DUF246 domain-containing protein ... 65 8e-09 emb|CAN71444.1| hypothetical protein VITISV_036923 [Vitis vinifera] 63 3e-08 ref|XP_002284058.1| PREDICTED: DUF246 domain-containing protein ... 62 4e-08 emb|CBI19199.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002513963.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_004152623.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449503909|ref|XP_004162223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 534 Score = 64.7 bits (156), Expect = 8e-09 Identities = 42/87 (48%), Positives = 52/87 (59%), Gaps = 6/87 (6%) Frame = -2 Query: 243 MQKWRRRTVAVVRKLLTCAIGAIAVVFLVSVHTQVQLPSSEVT------KLPTTQHEIEH 82 M K RRR VAV+RKLLT AI I ++ L+SVH PSS+V KLP Q E +H Sbjct: 1 MLKRRRRAVAVLRKLLTFAICFIGLLALLSVHLHF-FPSSQVPGFSDSHKLPA-QREFKH 58 Query: 81 QNLQTEGSWDRELAPPYFSKTSHSPRK 1 Q L TE SW +E+ P + SK + RK Sbjct: 59 QRLSTENSWTQEIVPLHLSKAPVASRK 85 >emb|CAN71444.1| hypothetical protein VITISV_036923 [Vitis vinifera] Length = 513 Score = 62.8 bits (151), Expect = 3e-08 Identities = 44/87 (50%), Positives = 52/87 (59%), Gaps = 6/87 (6%) Frame = -2 Query: 243 MQKWRR-RTVAVVRKLLTCAIGAIAVVFLVSVHTQVQLPS-----SEVTKLPTTQHEIEH 82 MQK R R + V+R+LL AI +IA V L+SVH V L S S+ KLPT QHEI Sbjct: 1 MQKRSRWRGLVVLRRLLIGAICSIAAVALLSVHVHVFLSSKVPDFSDSYKLPT-QHEIGF 59 Query: 81 QNLQTEGSWDRELAPPYFSKTSHSPRK 1 Q L TE W +ELAPP+ SK RK Sbjct: 60 QRLSTERKWVQELAPPHLSKAPLPSRK 86 >ref|XP_002284058.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 730 Score = 62.4 bits (150), Expect = 4e-08 Identities = 43/87 (49%), Positives = 52/87 (59%), Gaps = 6/87 (6%) Frame = -2 Query: 243 MQKWRR-RTVAVVRKLLTCAIGAIAVVFLVSVHTQVQLPS-----SEVTKLPTTQHEIEH 82 MQK R R + V+R+LL AI +IA V L+SVH + L S S+ KLPT QHEI Sbjct: 1 MQKRSRWRGLVVLRRLLIGAICSIAAVALLSVHVHIFLSSKVPDFSDSYKLPT-QHEIGF 59 Query: 81 QNLQTEGSWDRELAPPYFSKTSHSPRK 1 Q L TE W +ELAPP+ SK RK Sbjct: 60 QRLSTERKWVQELAPPHLSKAPLPSRK 86 >emb|CBI19199.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 62.4 bits (150), Expect = 4e-08 Identities = 43/87 (49%), Positives = 52/87 (59%), Gaps = 6/87 (6%) Frame = -2 Query: 243 MQKWRR-RTVAVVRKLLTCAIGAIAVVFLVSVHTQVQLPS-----SEVTKLPTTQHEIEH 82 MQK R R + V+R+LL AI +IA V L+SVH + L S S+ KLPT QHEI Sbjct: 1 MQKRSRWRGLVVLRRLLIGAICSIAAVALLSVHVHIFLSSKVPDFSDSYKLPT-QHEIGF 59 Query: 81 QNLQTEGSWDRELAPPYFSKTSHSPRK 1 Q L TE W +ELAPP+ SK RK Sbjct: 60 QRLSTERKWVQELAPPHLSKAPLPSRK 86 >ref|XP_002513963.1| conserved hypothetical protein [Ricinus communis] gi|223547049|gb|EEF48546.1| conserved hypothetical protein [Ricinus communis] Length = 536 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = -2 Query: 243 MQKWRRRTVAVVRKLLTCAIGAIAVVFLVSVHTQVQLPSSEVTKLPTTQHEIEHQNLQ-- 70 +QK + + V V+RK+LTCAI I ++ L+SVH QV PSS V LP + + Q Sbjct: 3 LQKRKWKAVVVMRKMLTCAICTITMIALLSVHVQV-FPSSSVPALPDLKFQTTTSTSQHD 61 Query: 69 TEGSWDRELAPPYFSK 22 E SW RE PP+ SK Sbjct: 62 QEQSWSREPTPPHLSK 77