BLASTX nr result
ID: Cephaelis21_contig00025494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025494 (692 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516715.1| Phytochromobilin:ferredoxin oxidoreductase, ... 60 3e-07 ref|NP_001234133.1| phytochromobilin synthase [Solanum lycopersi... 60 5e-07 ref|XP_004166104.1| PREDICTED: phytochromobilin:ferredoxin oxido... 59 7e-07 ref|XP_004139053.1| PREDICTED: phytochromobilin:ferredoxin oxido... 59 7e-07 gb|AEK05994.1| heme oxygenase 2 protein 2 [Populus balsamifera] ... 58 2e-06 >ref|XP_002516715.1| Phytochromobilin:ferredoxin oxidoreductase, chloroplast precursor, putative [Ricinus communis] gi|223544210|gb|EEF45734.1| Phytochromobilin:ferredoxin oxidoreductase, chloroplast precursor, putative [Ricinus communis] Length = 330 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 LQVLDFAVFPRPEFDLPIFCANCFTAASTNIVVL 1 +QVLDF V PRPEFD+PIFCAN FTAAS NI+VL Sbjct: 108 MQVLDFTVLPRPEFDVPIFCANFFTAASMNIIVL 141 >ref|NP_001234133.1| phytochromobilin synthase [Solanum lycopersicum] gi|62149356|dbj|BAD93478.1| phytochromobilin synthase [Solanum lycopersicum] gi|62149358|dbj|BAD93479.1| phytochromobilin synthase [Solanum lycopersicum] Length = 342 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 102 LQVLDFAVFPRPEFDLPIFCANCFTAASTNIVVL 1 +QVLDFA FP+PEFDLPIFCAN FT A NI+VL Sbjct: 119 MQVLDFAAFPKPEFDLPIFCANFFTTAKMNIIVL 152 >ref|XP_004166104.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic-like [Cucumis sativus] Length = 322 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 102 LQVLDFAVFPRPEFDLPIFCANCFTAASTNIVVL 1 +QVLDFA FP PEFD+PIFCAN FTAA+++IVVL Sbjct: 100 VQVLDFAAFPEPEFDIPIFCANIFTAANSSIVVL 133 >ref|XP_004139053.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic-like [Cucumis sativus] Length = 322 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 102 LQVLDFAVFPRPEFDLPIFCANCFTAASTNIVVL 1 +QVLDFA FP PEFD+PIFCAN FTAA+++IVVL Sbjct: 100 VQVLDFAAFPEPEFDIPIFCANIFTAANSSIVVL 133 >gb|AEK05994.1| heme oxygenase 2 protein 2 [Populus balsamifera] gi|339778227|gb|AEK05995.1| heme oxygenase 2 protein 2 [Populus balsamifera] Length = 326 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 102 LQVLDFAVFPRPEFDLPIFCANCFTAASTNIVVL 1 +Q+LDFAVF RPEFD+PIFCAN FT A+ NI+VL Sbjct: 104 IQILDFAVFSRPEFDVPIFCANFFTTATMNIIVL 137