BLASTX nr result
ID: Cephaelis21_contig00024905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024905 (1027 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276502.1| PREDICTED: splicing factor U2af small subuni... 99 2e-24 dbj|BAJ34257.1| unnamed protein product [Thellungiella halophila] 98 6e-24 ref|NP_174086.1| splicing factor U2af small subunit A [Arabidops... 98 6e-24 ref|XP_002890741.1| hypothetical protein ARALYDRAFT_472969 [Arab... 98 6e-24 ref|NP_001077609.1| splicing factor U2af small subunit A [Arabid... 98 6e-24 >ref|XP_002276502.1| PREDICTED: splicing factor U2af small subunit B isoform 1 [Vitis vinifera] gi|359491881|ref|XP_003634337.1| PREDICTED: splicing factor U2af small subunit B isoform 2 [Vitis vinifera] Length = 272 Score = 99.0 bits (245), Expect(2) = 2e-24 Identities = 50/62 (80%), Positives = 52/62 (83%) Frame = -3 Query: 374 KLGKFGEIESLNFYDNLADHMIGNVYV*FKEEE*AAATLQSLYGRFYSGRPIITDFSPSL 195 +LGKFGEIESLN DNLADHMIGNVYV FKEEE AAA LQ+L GRFYSGRPII DFSP Sbjct: 88 ELGKFGEIESLNVCDNLADHMIGNVYVQFKEEEQAAAALQALQGRFYSGRPIIADFSPVT 147 Query: 194 TF 189 F Sbjct: 148 DF 149 Score = 40.8 bits (94), Expect(2) = 2e-24 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 204 PVTDFREVTYRQFEENNCN 148 PVTDFRE T RQFEENNCN Sbjct: 145 PVTDFREATCRQFEENNCN 163 >dbj|BAJ34257.1| unnamed protein product [Thellungiella halophila] Length = 308 Score = 98.2 bits (243), Expect(2) = 6e-24 Identities = 49/62 (79%), Positives = 52/62 (83%) Frame = -3 Query: 374 KLGKFGEIESLNFYDNLADHMIGNVYV*FKEEE*AAATLQSLYGRFYSGRPIITDFSPSL 195 +LGKFGEIESLN DNLADHMIGNVYV FKEE+ AAA LQ+L GRFYSGRPII DFSP Sbjct: 88 ELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSGRPIIADFSPVT 147 Query: 194 TF 189 F Sbjct: 148 DF 149 Score = 39.7 bits (91), Expect(2) = 6e-24 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 204 PVTDFREVTYRQFEENNCN 148 PVTDFRE T RQ+EENNCN Sbjct: 145 PVTDFREATCRQYEENNCN 163 >ref|NP_174086.1| splicing factor U2af small subunit A [Arabidopsis thaliana] gi|75336807|sp|Q9S709.1|U2AFA_ARATH RecName: Full=Splicing factor U2af small subunit A; AltName: Full=U2 auxiliary factor 35 kDa subunit A; AltName: Full=U2 small nuclear ribonucleoprotein auxiliary factor small subunit A; Short=U2 snRNP auxiliary factor small subunit A; AltName: Full=Zinc finger CCCH domain-containing protein 8; Short=AtC3H8 gi|5668775|gb|AAD46002.1|AC005916_14 Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 come from this gene [Arabidopsis thaliana] gi|6693017|gb|AAF24943.1|AC012375_6 T22C5.10 [Arabidopsis thaliana] gi|12744991|gb|AAK06875.1|AF344324_1 putative U2 snRNP auxiliary factor [Arabidopsis thaliana] gi|17528936|gb|AAL38678.1| putative U2 snRNP auxiliary factor [Arabidopsis thaliana] gi|19699275|gb|AAL91249.1| At1g27650/T22C5_2 [Arabidopsis thaliana] gi|20465943|gb|AAM20157.1| putative U2 snRNP auxiliary factor protein [Arabidopsis thaliana] gi|21595106|gb|AAM66073.1| putative U2 snRNP auxiliary factor [Arabidopsis thaliana] gi|21689611|gb|AAM67427.1| At1g27650/T22C5_2 [Arabidopsis thaliana] gi|332192737|gb|AEE30858.1| splicing factor U2af small subunit A [Arabidopsis thaliana] Length = 296 Score = 98.2 bits (243), Expect(2) = 6e-24 Identities = 49/62 (79%), Positives = 52/62 (83%) Frame = -3 Query: 374 KLGKFGEIESLNFYDNLADHMIGNVYV*FKEEE*AAATLQSLYGRFYSGRPIITDFSPSL 195 +LGKFGEIESLN DNLADHMIGNVYV FKEE+ AAA LQ+L GRFYSGRPII DFSP Sbjct: 88 ELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSGRPIIADFSPVT 147 Query: 194 TF 189 F Sbjct: 148 DF 149 Score = 39.7 bits (91), Expect(2) = 6e-24 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 204 PVTDFREVTYRQFEENNCN 148 PVTDFRE T RQ+EENNCN Sbjct: 145 PVTDFREATCRQYEENNCN 163 >ref|XP_002890741.1| hypothetical protein ARALYDRAFT_472969 [Arabidopsis lyrata subsp. lyrata] gi|297336583|gb|EFH67000.1| hypothetical protein ARALYDRAFT_472969 [Arabidopsis lyrata subsp. lyrata] Length = 296 Score = 98.2 bits (243), Expect(2) = 6e-24 Identities = 49/62 (79%), Positives = 52/62 (83%) Frame = -3 Query: 374 KLGKFGEIESLNFYDNLADHMIGNVYV*FKEEE*AAATLQSLYGRFYSGRPIITDFSPSL 195 +LGKFGEIESLN DNLADHMIGNVYV FKEE+ AAA LQ+L GRFYSGRPII DFSP Sbjct: 88 ELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSGRPIIADFSPVT 147 Query: 194 TF 189 F Sbjct: 148 DF 149 Score = 39.7 bits (91), Expect(2) = 6e-24 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 204 PVTDFREVTYRQFEENNCN 148 PVTDFRE T RQ+EENNCN Sbjct: 145 PVTDFREATCRQYEENNCN 163 >ref|NP_001077609.1| splicing factor U2af small subunit A [Arabidopsis thaliana] gi|332192738|gb|AEE30859.1| splicing factor U2af small subunit A [Arabidopsis thaliana] Length = 246 Score = 98.2 bits (243), Expect(2) = 6e-24 Identities = 49/62 (79%), Positives = 52/62 (83%) Frame = -3 Query: 374 KLGKFGEIESLNFYDNLADHMIGNVYV*FKEEE*AAATLQSLYGRFYSGRPIITDFSPSL 195 +LGKFGEIESLN DNLADHMIGNVYV FKEE+ AAA LQ+L GRFYSGRPII DFSP Sbjct: 38 ELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSGRPIIADFSPVT 97 Query: 194 TF 189 F Sbjct: 98 DF 99 Score = 39.7 bits (91), Expect(2) = 6e-24 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 204 PVTDFREVTYRQFEENNCN 148 PVTDFRE T RQ+EENNCN Sbjct: 95 PVTDFREATCRQYEENNCN 113