BLASTX nr result
ID: Cephaelis21_contig00024904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024904 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511252.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_002262922.2| PREDICTED: telomere length regulation protei... 63 2e-08 emb|CBI14866.3| unnamed protein product [Vitis vinifera] 63 2e-08 ref|XP_004162143.1| PREDICTED: LOW QUALITY PROTEIN: telomere len... 62 4e-08 ref|XP_004152588.1| PREDICTED: telomere length regulation protei... 62 4e-08 >ref|XP_002511252.1| conserved hypothetical protein [Ricinus communis] gi|223550367|gb|EEF51854.1| conserved hypothetical protein [Ricinus communis] Length = 986 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 31 FQLAMTCLQLHSEMALQASRALESRENTLGGDNIGLPSPLTKGIIKIPYRNAE 189 + +AM CLQLH+EMALQASRALE+ E+TL +G PS L++G I+IPY N E Sbjct: 933 YMMAMRCLQLHAEMALQASRALEAAESTLKAKKVGFPSSLSRGTIRIPYSNVE 985 >ref|XP_002262922.2| PREDICTED: telomere length regulation protein TEL2 homolog [Vitis vinifera] Length = 1041 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +1 Query: 31 FQLAMTCLQLHSEMALQASRALESRENTLGGDNIGLPSPLTKGIIKIPYRNAE 189 + +AMTCLQLH+EMALQASRALE+ E+T +IGL S + KG IKIP+ + + Sbjct: 988 YTMAMTCLQLHAEMALQASRALETSESTFKTKSIGLSSNMLKGEIKIPHPSVQ 1040 >emb|CBI14866.3| unnamed protein product [Vitis vinifera] Length = 1056 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +1 Query: 31 FQLAMTCLQLHSEMALQASRALESRENTLGGDNIGLPSPLTKGIIKIPYRNAE 189 + +AMTCLQLH+EMALQASRALE+ E+T +IGL S + KG IKIP+ + + Sbjct: 1003 YTMAMTCLQLHAEMALQASRALETSESTFKTKSIGLSSNMLKGEIKIPHPSVQ 1055 >ref|XP_004162143.1| PREDICTED: LOW QUALITY PROTEIN: telomere length regulation protein TEL2 homolog [Cucumis sativus] Length = 884 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 31 FQLAMTCLQLHSEMALQASRALESRENTLGGDNIGLPSPLTKGIIKIPYRNAE 189 + +AMTCLQLHSEMALQA+R LES +T NI S L+KG IKIP+ + + Sbjct: 831 YMMAMTCLQLHSEMALQATRTLESANSTFKPKNIAFTSDLSKGTIKIPFSDVK 883 >ref|XP_004152588.1| PREDICTED: telomere length regulation protein TEL2 homolog [Cucumis sativus] Length = 1028 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 31 FQLAMTCLQLHSEMALQASRALESRENTLGGDNIGLPSPLTKGIIKIPYRNAE 189 + +AMTCLQLHSEMALQA+R LES +T NI S L+KG IKIP+ + + Sbjct: 975 YMMAMTCLQLHSEMALQATRTLESANSTFKPKNIAFTSDLSKGTIKIPFSDVK 1027