BLASTX nr result
ID: Cephaelis21_contig00024835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024835 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458659.1| hypothetical protein SORBIDRAFT_03g037600 [S... 87 1e-15 gb|AFW84805.1| U3 small nucleolar RNA-associated protein 11 [Zea... 86 2e-15 gb|AFW84804.1| hypothetical protein ZEAMMB73_323251 [Zea mays] 86 2e-15 ref|XP_002517659.1| U3 small nucleolar RNA-associated protein, p... 84 2e-14 ref|XP_002322578.1| predicted protein [Populus trichocarpa] gi|2... 84 2e-14 >ref|XP_002458659.1| hypothetical protein SORBIDRAFT_03g037600 [Sorghum bicolor] gi|241930634|gb|EES03779.1| hypothetical protein SORBIDRAFT_03g037600 [Sorghum bicolor] Length = 232 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 132 MSSLRNAIPRRAHKERSQPQARRKFGLLEKHKDYVVRARSYHQKE 266 MSSLRNAIPRRAHKERSQP+AR+KFGLLEKHKDYVVRAR+YH KE Sbjct: 1 MSSLRNAIPRRAHKERSQPEARKKFGLLEKHKDYVVRARAYHIKE 45 >gb|AFW84805.1| U3 small nucleolar RNA-associated protein 11 [Zea mays] Length = 232 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 132 MSSLRNAIPRRAHKERSQPQARRKFGLLEKHKDYVVRARSYHQKE 266 MSSLRNAIPRRAHKER+QP+AR+KFGLLEKHKDYVVRAR+YH KE Sbjct: 1 MSSLRNAIPRRAHKERAQPEARKKFGLLEKHKDYVVRARAYHIKE 45 >gb|AFW84804.1| hypothetical protein ZEAMMB73_323251 [Zea mays] Length = 215 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 132 MSSLRNAIPRRAHKERSQPQARRKFGLLEKHKDYVVRARSYHQKE 266 MSSLRNAIPRRAHKER+QP+AR+KFGLLEKHKDYVVRAR+YH KE Sbjct: 1 MSSLRNAIPRRAHKERAQPEARKKFGLLEKHKDYVVRARAYHIKE 45 >ref|XP_002517659.1| U3 small nucleolar RNA-associated protein, putative [Ricinus communis] gi|223543291|gb|EEF44823.1| U3 small nucleolar RNA-associated protein, putative [Ricinus communis] Length = 231 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = +3 Query: 132 MSSLRNAIPRRAHKERSQPQARRKFGLLEKHKDYVVRARSYHQKE 266 MSSLRNAIPR+AHKERSQPQ+R+K+GLLEKHKDY+VRA+++H+KE Sbjct: 1 MSSLRNAIPRKAHKERSQPQSRKKYGLLEKHKDYIVRAKAFHKKE 45 >ref|XP_002322578.1| predicted protein [Populus trichocarpa] gi|222867208|gb|EEF04339.1| predicted protein [Populus trichocarpa] Length = 229 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = +3 Query: 132 MSSLRNAIPRRAHKERSQPQARRKFGLLEKHKDYVVRARSYHQKE 266 MSSLRNAIPR+AHKER+QPQAR+KFGLLEKHKDYV RA+++H+KE Sbjct: 1 MSSLRNAIPRKAHKERAQPQARKKFGLLEKHKDYVARAKAFHKKE 45