BLASTX nr result
ID: Cephaelis21_contig00024735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024735 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316452.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 emb|CBI25280.3| unnamed protein product [Vitis vinifera] 62 5e-08 dbj|BAB01713.1| unnamed protein product [Arabidopsis thaliana] 62 5e-08 ref|XP_002311913.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002273578.1| PREDICTED: cell wall integrity protein scw1-... 59 3e-07 >ref|XP_002316452.1| predicted protein [Populus trichocarpa] gi|222865492|gb|EEF02623.1| predicted protein [Populus trichocarpa] Length = 281 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 528 DVNTATNVHHTLQGAVIPSSGSVGMRIQYPF 436 D+N+ATNVHHTLQGAVIPSSGSVGMRIQYPF Sbjct: 221 DLNSATNVHHTLQGAVIPSSGSVGMRIQYPF 251 >emb|CBI25280.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 DVNTATNVHHTLQGAVIPSSGSVGMRIQYP 439 D+NTATNVHH+LQGAVIPSSGSVGMRIQYP Sbjct: 270 DMNTATNVHHSLQGAVIPSSGSVGMRIQYP 299 >dbj|BAB01713.1| unnamed protein product [Arabidopsis thaliana] Length = 317 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 528 DVNTATNVHHTLQGAVIPSSGSVGMRIQYPF 436 DVN+ATNVHH LQGAVIPSSGS+GMRIQYP+ Sbjct: 279 DVNSATNVHHNLQGAVIPSSGSIGMRIQYPY 309 >ref|XP_002311913.1| predicted protein [Populus trichocarpa] gi|222851733|gb|EEE89280.1| predicted protein [Populus trichocarpa] Length = 302 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 528 DVNTATNVHHTLQGAVIPSSGSVGMRIQYP 439 D+N+ATNVHH+LQGAVIPSSGS+GMRIQYP Sbjct: 273 DLNSATNVHHSLQGAVIPSSGSIGMRIQYP 302 >ref|XP_002273578.1| PREDICTED: cell wall integrity protein scw1-like [Vitis vinifera] Length = 328 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 528 DVNTATNVHHTLQGAVIPSSGSVGMRIQY 442 D+NTATNVHH+LQGAVIPSSGSVGMRIQY Sbjct: 270 DMNTATNVHHSLQGAVIPSSGSVGMRIQY 298