BLASTX nr result
ID: Cephaelis21_contig00024723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024723 (723 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] 66 8e-09 ref|XP_004137790.1| PREDICTED: histone H2B.4-like [Cucumis sativus] 66 8e-09 ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064|... 66 8e-09 ref|XP_002884739.1| hypothetical protein ARALYDRAFT_478268 [Arab... 66 8e-09 ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arab... 66 8e-09 >ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 138 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 324 MKKSSETYNIYIFKVRKQVHPDNEISNNALDIMNSFIKDTFEKL 455 +KKS+ETY IYIFKV KQVHPD IS+ A+ IMNSFI D FEKL Sbjct: 44 VKKSNETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 87 >ref|XP_004137790.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 138 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 324 MKKSSETYNIYIFKVRKQVHPDNEISNNALDIMNSFIKDTFEKL 455 +KKS+ETY IYIFKV KQVHPD IS+ A+ IMNSFI D FEKL Sbjct: 44 VKKSNETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 87 >ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064|sp|Q9SI96.3|H2B3_ARATH RecName: Full=Histone H2B.3; Short=HTB3 gi|13272409|gb|AAK17143.1|AF325075_1 putative histone H2B [Arabidopsis thaliana] gi|4580384|gb|AAD24363.1| putative histone H2B [Arabidopsis thaliana] gi|16209685|gb|AAL14400.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|21553526|gb|AAM62619.1| putative histone H2B [Arabidopsis thaliana] gi|21700841|gb|AAM70544.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|330253069|gb|AEC08163.1| histone H2B [Arabidopsis thaliana] Length = 151 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 324 MKKSSETYNIYIFKVRKQVHPDNEISNNALDIMNSFIKDTFEKL 455 +KKS+ETY IYIFKV KQVHPD IS+ A+ IMNSFI D FEKL Sbjct: 57 VKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 100 >ref|XP_002884739.1| hypothetical protein ARALYDRAFT_478268 [Arabidopsis lyrata subsp. lyrata] gi|297330579|gb|EFH60998.1| hypothetical protein ARALYDRAFT_478268 [Arabidopsis lyrata subsp. lyrata] Length = 126 Score = 65.9 bits (159), Expect = 8e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 327 KKSSETYNIYIFKVRKQVHPDNEISNNALDIMNSFIKDTFEKL 455 KKS+ETY IY+FKV KQVHPD IS A+ IMNSFI DTFEK+ Sbjct: 33 KKSTETYKIYLFKVLKQVHPDIGISGKAMGIMNSFINDTFEKI 75 >ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] gi|297325021|gb|EFH55441.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] Length = 154 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 324 MKKSSETYNIYIFKVRKQVHPDNEISNNALDIMNSFIKDTFEKL 455 +KKS+ETY IYIFKV KQVHPD IS+ A+ IMNSFI D FEKL Sbjct: 60 VKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 103