BLASTX nr result
ID: Cephaelis21_contig00024677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024677 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269607.1| PREDICTED: beta-1,3-galactosyltransferase 15... 56 3e-06 >ref|XP_002269607.1| PREDICTED: beta-1,3-galactosyltransferase 15 [Vitis vinifera] gi|296086360|emb|CBI31949.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/67 (50%), Positives = 41/67 (61%) Frame = -1 Query: 227 ASLLMLFVLGYYVVRNPFKENNLASQNSIFNSTNPLE*INVDASPVVQNIGNTSEGISTE 48 ASL ML VL Y ++NP ++ L S S NSTNPLE IN PVVQN N S+ IS + Sbjct: 11 ASLFMLLVLRYVFMKNPISDSYLTSPFSS-NSTNPLEWINAGVLPVVQNPENASQVISAD 69 Query: 47 DIL*SFF 27 I+ S F Sbjct: 70 SIVSSLF 76