BLASTX nr result
ID: Cephaelis21_contig00024659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024659 (915 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX96125.1| retrotransposon protein, putative, unclassified [... 55 3e-07 emb|CAN66228.1| hypothetical protein VITISV_012977 [Vitis vinifera] 55 3e-06 gb|AAF71196.1| pol protein integrase region [Pinus brutia] 55 3e-06 ref|XP_003573116.1| PREDICTED: uncharacterized protein LOC100827... 57 6e-06 gb|AAF71149.1| pol protein integrase region, partial [Abies alba] 57 6e-06 >gb|AAX96125.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] gi|77550700|gb|ABA93497.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 1448 Score = 55.1 bits (131), Expect(2) = 3e-07 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -1 Query: 183 SYLYHPQSDGQIERLN*CLQTYLRCFKRDKCNSWENWLAMTQ 58 S YHPQ+DGQ ER+N CL+TYLRCF + W WL + + Sbjct: 1126 STAYHPQTDGQTERVNQCLETYLRCFTHSCPSKWSTWLYLAE 1167 Score = 26.2 bits (56), Expect(2) = 3e-07 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 266 ISMNCKIFLSNF*QALFRTLGVPSHFST 183 +S + KIF SNF + LF+++ H ST Sbjct: 1100 VSDHDKIFTSNFWEQLFQSVSTKLHMST 1127 >emb|CAN66228.1| hypothetical protein VITISV_012977 [Vitis vinifera] Length = 1258 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = -1 Query: 186 HSYLYHPQSDGQIERLN*CLQTYLRCFKRDKCNSWENWL 70 HS YHPQ+DGQ E +N C++TYLRCF +K W WL Sbjct: 1028 HSTAYHPQTDGQTEVVNRCVETYLRCFSYNKPRRWSTWL 1066 Score = 22.3 bits (46), Expect(2) = 3e-06 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 Query: 266 ISMNCKIFLSNF*QALFRTLGVPSHFST 183 +S K+FLS F LFR LG ST Sbjct: 1003 VSDRDKVFLSLFWTKLFRLLGTSLCHST 1030 >gb|AAF71196.1| pol protein integrase region [Pinus brutia] Length = 131 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -1 Query: 174 YHPQSDGQIERLN*CLQTYLRCFKRDKCNSWENWLAMTQ 58 YHPQ+DGQ E +N CL+TYLRCF +K + W WL + + Sbjct: 93 YHPQTDGQTEAVNKCLETYLRCFTSEKQHLWVQWLPLAE 131 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 248 IFLSNF*QALFRTLGVPSHFST 183 IF SNF Q LFR G ST Sbjct: 70 IFTSNFWQELFRIQGTQLKLST 91 >ref|XP_003573116.1| PREDICTED: uncharacterized protein LOC100827899 [Brachypodium distachyon] Length = 1665 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -1 Query: 195 TFQHSYLYHPQSDGQIERLN*CLQTYLRCFKRDKCNSWENWLAMTQ 58 T S YHPQ+DGQ ERLN CL+TYLRC K N W WL + Sbjct: 1382 TLNLSSSYHPQTDGQTERLNQCLETYLRCLVHAKPNRWARWLPQAE 1427 >gb|AAF71149.1| pol protein integrase region, partial [Abies alba] Length = 131 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -1 Query: 186 HSYLYHPQSDGQIERLN*CLQTYLRCFKRDKCNSWENWLAMTQ 58 HS YHPQSDGQ E +N CL+ YLRCF DK W WL + + Sbjct: 89 HSSSYHPQSDGQTEIVNKCLEGYLRCFVSDKQTQWVRWLPLAE 131