BLASTX nr result
ID: Cephaelis21_contig00024653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024653 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA17732.1| cytochrome P450 [Catharanthus roseus] 85 5e-15 gb|AAA17746.1| cytochrome P450, partial [Catharanthus roseus] 84 1e-14 sp|Q05047.1|C72A1_CATRO RecName: Full=Secologanin synthase; Shor... 84 1e-14 dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza urale... 82 5e-14 dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula] 82 5e-14 >gb|AAA17732.1| cytochrome P450 [Catharanthus roseus] Length = 524 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/70 (54%), Positives = 51/70 (72%) Frame = +1 Query: 10 LAVHWCYRVLVWAWIRPKRLEKILREQGFKGNAYRPFLGDQYESEKLIREAMSKPIGLDE 189 L V W +RVL WAW PKR+EK LR+QGF+GN YR +GD ES K+ +EA+SKP+ + Sbjct: 19 LVVAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVKESGKMHQEALSKPMEFNN 78 Query: 190 DVNKRIIPHI 219 D+ R++PHI Sbjct: 79 DIVPRLMPHI 88 >gb|AAA17746.1| cytochrome P450, partial [Catharanthus roseus] Length = 516 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/70 (52%), Positives = 50/70 (71%) Frame = +1 Query: 10 LAVHWCYRVLVWAWIRPKRLEKILREQGFKGNAYRPFLGDQYESEKLIREAMSKPIGLDE 189 L + W +RVL WAW PKR+EK LR+QGF+GN YR +GD ES K+ +EA+S P+ D Sbjct: 8 LVMAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVKESGKMHQEALSNPMEFDN 67 Query: 190 DVNKRIIPHI 219 D+ R++PHI Sbjct: 68 DIVPRLMPHI 77 >sp|Q05047.1|C72A1_CATRO RecName: Full=Secologanin synthase; Short=SLS; AltName: Full=CYPLXXII; AltName: Full=Cytochrome P450 72A1 gi|167484|gb|AAA33106.1| cytochrome P-450 protein [Catharanthus roseus] gi|445604|prf||1909351A cytochrome P450 Length = 524 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/70 (52%), Positives = 51/70 (72%) Frame = +1 Query: 10 LAVHWCYRVLVWAWIRPKRLEKILREQGFKGNAYRPFLGDQYESEKLIREAMSKPIGLDE 189 L + W +RVL WAW PKR+EK LR+QGF+GN YR +GD ES K+ +EA+SKP+ + Sbjct: 19 LVMAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVKESGKMHQEALSKPMEFNN 78 Query: 190 DVNKRIIPHI 219 D+ R++PHI Sbjct: 79 DIVPRLMPHI 88 >dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis] Length = 522 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/72 (48%), Positives = 52/72 (72%) Frame = +1 Query: 4 IGLAVHWCYRVLVWAWIRPKRLEKILREQGFKGNAYRPFLGDQYESEKLIREAMSKPIGL 183 I LAV W +R+L W W+RPK+LE++LREQG +GN YR +GD + K+ +EA SKP+ L Sbjct: 17 IVLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKPMNL 76 Query: 184 DEDVNKRIIPHI 219 +D+ R+ P++ Sbjct: 77 SDDILPRVFPYV 88 >dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula] Length = 520 Score = 82.0 bits (201), Expect = 5e-14 Identities = 39/72 (54%), Positives = 53/72 (73%) Frame = +1 Query: 4 IGLAVHWCYRVLVWAWIRPKRLEKILREQGFKGNAYRPFLGDQYESEKLIREAMSKPIGL 183 +GL W RVL W W++PKRLEK+LREQG KGN+YR LGD +S K+ ++A SKP+ L Sbjct: 18 LGLVYTW--RVLNWIWLKPKRLEKLLREQGCKGNSYRLVLGDLKDSYKMGKQAKSKPMEL 75 Query: 184 DEDVNKRIIPHI 219 +D+ R+IP+I Sbjct: 76 SDDIIPRVIPYI 87