BLASTX nr result
ID: Cephaelis21_contig00024498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024498 (886 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABS72112.1| ankyrin repeat-rich protein [Solanum tuberosum] 81 4e-13 dbj|BAB09592.1| unnamed protein product [Arabidopsis thaliana] 80 6e-13 ref|XP_002866226.1| XBAT32 [Arabidopsis lyrata subsp. lyrata] gi... 80 6e-13 ref|NP_200582.3| E3 ubiquitin-protein ligase XBAT32 [Arabidopsis... 80 6e-13 gb|ACT37362.1| ankyrin repeat-rich protein [Nicotiana benthamiana] 79 1e-12 >gb|ABS72112.1| ankyrin repeat-rich protein [Solanum tuberosum] Length = 514 Score = 80.9 bits (198), Expect = 4e-13 Identities = 41/51 (80%), Positives = 43/51 (84%) Frame = +1 Query: 733 DGDL*EAKALLDYNPRLVRYSTFGVLNSPLHYSAAQGHHEACVLYILRVGV 885 DGD+ EAKALLDYNPRLVRYSTFGV NSPLHYSAAQGHHE V +L GV Sbjct: 34 DGDIQEAKALLDYNPRLVRYSTFGVRNSPLHYSAAQGHHE-IVSLLLESGV 83 >dbj|BAB09592.1| unnamed protein product [Arabidopsis thaliana] Length = 468 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = +1 Query: 733 DGDL*EAKALLDYNPRLVRYSTFGVLNSPLHYSAAQGHHEACVLYI 870 DGDL EAKALLDYNPRL RYSTFGV NSPLHYSAAQGHHE L + Sbjct: 26 DGDLQEAKALLDYNPRLARYSTFGVRNSPLHYSAAQGHHEIVSLLV 71 >ref|XP_002866226.1| XBAT32 [Arabidopsis lyrata subsp. lyrata] gi|297312061|gb|EFH42485.1| XBAT32 [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = +1 Query: 733 DGDL*EAKALLDYNPRLVRYSTFGVLNSPLHYSAAQGHHEACVLYI 870 DGDL EAKALLDYNPRL RYSTFGV NSPLHYSAAQGHHE L + Sbjct: 26 DGDLQEAKALLDYNPRLARYSTFGVRNSPLHYSAAQGHHEIVSLLV 71 >ref|NP_200582.3| E3 ubiquitin-protein ligase XBAT32 [Arabidopsis thaliana] gi|75324323|sp|Q6NLQ8.1|XB32_ARATH RecName: Full=E3 ubiquitin-protein ligase XBAT32; AltName: Full=Ankyrin repeat domain and RING finger-containing protein XBAT32; AltName: Full=Protein XB3 homolog 2 gi|44917453|gb|AAS49051.1| At5g57740 [Arabidopsis thaliana] gi|45773910|gb|AAS76759.1| At5g57740 [Arabidopsis thaliana] gi|332009561|gb|AED96944.1| E3 ubiquitin-protein ligase XBAT32 [Arabidopsis thaliana] Length = 508 Score = 80.1 bits (196), Expect = 6e-13 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = +1 Query: 733 DGDL*EAKALLDYNPRLVRYSTFGVLNSPLHYSAAQGHHEACVLYI 870 DGDL EAKALLDYNPRL RYSTFGV NSPLHYSAAQGHHE L + Sbjct: 26 DGDLQEAKALLDYNPRLARYSTFGVRNSPLHYSAAQGHHEIVSLLV 71 >gb|ACT37362.1| ankyrin repeat-rich protein [Nicotiana benthamiana] Length = 513 Score = 79.3 bits (194), Expect = 1e-12 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = +1 Query: 733 DGDL*EAKALLDYNPRLVRYSTFGVLNSPLHYSAAQGHHEACVLYILRVGV 885 DGDL EAKALL+YNPRLVRYSTFGV NSPLHYSAAQGHH+ L +L GV Sbjct: 34 DGDLQEAKALLEYNPRLVRYSTFGVRNSPLHYSAAQGHHKIVTL-LLESGV 83