BLASTX nr result
ID: Cephaelis21_contig00024468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024468 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620... 64 1e-08 >ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620-like [Vitis vinifera] Length = 648 Score = 64.3 bits (155), Expect = 1e-08 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 11/88 (12%) Frame = -1 Query: 237 ETFLKTKKSVSSVNDD-----------LRRCFLESFHLNEPGSAPQNGIDEEDFVDSGLY 91 ETFL+ K+SV+S DD LRR LESFHLNE SAPQN DEED DS + Sbjct: 369 ETFLRAKQSVTSRRDDYSSPSEQKESRLRRHSLESFHLNEAVSAPQNAEDEEDSSDSDSH 428 Query: 90 FSEVKRGSTLMCRFSSRTCRSSVGSPAE 7 E+ +GS + S+ +C+ +G+ AE Sbjct: 429 CFELNKGSG--AKQSNGSCKKHIGNSAE 454