BLASTX nr result
ID: Cephaelis21_contig00024337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024337 (511 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621164.1| Receptor kinase [Medicago truncatula] gi|355... 59 2e-07 ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine... 56 3e-06 ref|XP_002333161.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_003621164.1| Receptor kinase [Medicago truncatula] gi|355496179|gb|AES77382.1| Receptor kinase [Medicago truncatula] Length = 799 Score = 58.5 bits (140), Expect(2) = 2e-07 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +3 Query: 330 PGITCNHAGLVTEIVRPNDY-IGVKFGNFSFHSFPHLVNLDLVDCGLTGIIPPQLGVLSK 506 PGITCN+ G +T I P + +G KFG F F SF +LV+L+L G+ G IP +L LSK Sbjct: 55 PGITCNNEGSITNISLPPEIQLGDKFGKFHFSSFTNLVHLNLASHGIIGNIPFELATLSK 114 Query: 507 L 509 L Sbjct: 115 L 115 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +1 Query: 259 LLNSGWWD 282 L+NSGWW+ Sbjct: 35 LVNSGWWN 42 >ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Length = 1037 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/59 (49%), Positives = 37/59 (62%) Frame = +3 Query: 333 GITCNHAGLVTEIVRPNDYIGVKFGNFSFHSFPHLVNLDLVDCGLTGIIPPQLGVLSKL 509 GI+CNHAG V I +G FSF SFP+L +D+ L+G IPPQ+G+LSKL Sbjct: 81 GISCNHAGSVIRINLTESGLGGTLQAFSFSSFPNLAYVDISMNNLSGPIPPQIGLLSKL 139 >ref|XP_002333161.1| predicted protein [Populus trichocarpa] gi|222835014|gb|EEE73463.1| predicted protein [Populus trichocarpa] Length = 827 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = +3 Query: 330 PGITCNHAGLVTEIVRPNDY--IGVKFGNFSFHSFPHLVNLDLVDCGLTGIIPPQLGVLS 503 PGI CN AG +T+I P ++ +G KFG +F F +LV L L + L G IPPQ+ +L Sbjct: 68 PGIFCNRAGSITKISPPPEFLKVGNKFGKMNFSCFSNLVRLHLPNHELNGSIPPQISILP 127 Query: 504 KL 509 +L Sbjct: 128 QL 129