BLASTX nr result
ID: Cephaelis21_contig00024067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00024067 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002441733.1| hypothetical protein SORBIDRAFT_08g001460 [S... 61 9e-08 ref|XP_002523900.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|NP_001144196.1| uncharacterized protein LOC100277056 [Zea ma... 61 1e-07 ref|NP_001143618.1| uncharacterized protein LOC100276333 [Zea ma... 61 1e-07 dbj|BAJ91600.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 2e-07 >ref|XP_002441733.1| hypothetical protein SORBIDRAFT_08g001460 [Sorghum bicolor] gi|241942426|gb|EES15571.1| hypothetical protein SORBIDRAFT_08g001460 [Sorghum bicolor] Length = 102 Score = 61.2 bits (147), Expect = 9e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 148 KDFLFFCNIAIDRSDEAKKILGKFAASVGLQLPDVYKP 35 KD LF NIA+DRSDE KKIL K AASVGLQLPDVY+P Sbjct: 65 KDLLFSYNIAVDRSDEMKKILNKSAASVGLQLPDVYQP 102 >ref|XP_002523900.1| conserved hypothetical protein [Ricinus communis] gi|223536830|gb|EEF38469.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 148 KDFLFFCNIAIDRSDEAKKILGKFAASVGLQLPDVYKP 35 KD LF NIA+DRSDE K+ILGK AASVGLQLP+VY+P Sbjct: 73 KDLLFSYNIAVDRSDEMKRILGKSAASVGLQLPEVYQP 110 >ref|NP_001144196.1| uncharacterized protein LOC100277056 [Zea mays] gi|195638254|gb|ACG38595.1| hypothetical protein [Zea mays] Length = 104 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -3 Query: 148 KDFLFFCNIAIDRSDEAKKILGKFAASVGLQLPDVYKP 35 KD L NIA+DRSDE KKIL K AASVGLQLPDVYKP Sbjct: 67 KDLLLSYNIAVDRSDETKKILNKSAASVGLQLPDVYKP 104 >ref|NP_001143618.1| uncharacterized protein LOC100276333 [Zea mays] gi|195623478|gb|ACG33569.1| hypothetical protein [Zea mays] gi|414882057|tpg|DAA59188.1| TPA: hypothetical protein ZEAMMB73_026461 [Zea mays] gi|414882058|tpg|DAA59189.1| TPA: hypothetical protein ZEAMMB73_585548 [Zea mays] Length = 104 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -3 Query: 148 KDFLFFCNIAIDRSDEAKKILGKFAASVGLQLPDVYKP 35 KD L NIA+DRSDE KKIL K AASVGLQLPDVYKP Sbjct: 67 KDLLLSYNIAVDRSDETKKILNKSAASVGLQLPDVYKP 104 >dbj|BAJ91600.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 104 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 151 RKDFLFFCNIAIDRSDEAKKILGKFAASVGLQLPDVYKP 35 +K+ LF NIA+DRSDE KKIL K AASVGLQLPDVY+P Sbjct: 66 QKELLFSYNIAVDRSDEMKKILNKSAASVGLQLPDVYQP 104