BLASTX nr result
ID: Cephaelis21_contig00023997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023997 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529729.1| conserved hypothetical protein [Ricinus comm... 55 9e-06 >ref|XP_002529729.1| conserved hypothetical protein [Ricinus communis] gi|223530793|gb|EEF32658.1| conserved hypothetical protein [Ricinus communis] Length = 290 Score = 54.7 bits (130), Expect = 9e-06 Identities = 47/144 (32%), Positives = 63/144 (43%), Gaps = 5/144 (3%) Frame = +2 Query: 2 YMKELCP--PKAKLPSTSDLTECTPVKCLEPKFMATSKDDSTPKMDGIASSP--NDNLVV 169 YMKE+ P PK K + S ++ P + + + ++ KD+ KMD I P D + Sbjct: 151 YMKEIWPSKPKQKPSAESKPSKSIPERSVSLENVSGIKDEMV-KMDEITLPPLSGDTCIT 209 Query: 170 NSPMTPSTKV-ATLLDTGXXXXXXXXXXXXXXXXXXXVTIDSEXXXXXXXXXXXXXXXXX 346 NSP TP K ATLLD + DSE Sbjct: 210 NSPATPLVKSGATLLDA---KRRKRNKSGAKETDSNKASKDSERTVNASSKRKRKSWTSL 266 Query: 347 XDIAERNEQDSSHNLTNLTIPFLV 418 +IAE E DS+ N+TNLTIPFL+ Sbjct: 267 KEIAESKEHDSTRNVTNLTIPFLI 290